Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	158835
Gene name	Acyl-CoA wax alcohol acyltransferase 2
Gene symbol	AWAT2
Synonyms (NCBI Gene)	ARATDC4DGAT2L4MFATWS
Chromosome	X
Chromosome location	Xq13.1
Summary	This gene encodes an enzyme belonging to the diacylglycerol acyltransferase family. This enzyme produces wax esters by the esterification of long chain (or wax) alcohols with acyl-CoA-derived fatty acids. It functions in lipid metabolism in the skin, most

37 Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531494	hsa-miR-339-5p	PAR-CLIP	22012620
MIRT531493	hsa-miR-645	PAR-CLIP	22012620
MIRT531492	hsa-miR-1236-3p	PAR-CLIP	22012620
MIRT531491	hsa-miR-670-5p	PAR-CLIP	22012620
MIRT531490	hsa-miR-578	PAR-CLIP	22012620
MIRT531494	hsa-miR-339-5p	PAR-CLIP	22012620
MIRT531493	hsa-miR-645	PAR-CLIP	22012620
MIRT531492	hsa-miR-1236-3p	PAR-CLIP	22012620
MIRT531491	hsa-miR-670-5p	PAR-CLIP	22012620
MIRT531490	hsa-miR-578	PAR-CLIP	22012620
MIRT812358	hsa-miR-1178	CLIP-seq
MIRT812359	hsa-miR-1200	CLIP-seq
MIRT812360	hsa-miR-1266	CLIP-seq
MIRT812361	hsa-miR-2115	CLIP-seq
MIRT812362	hsa-miR-4270	CLIP-seq
MIRT812363	hsa-miR-4324	CLIP-seq
MIRT812364	hsa-miR-4441	CLIP-seq
MIRT812365	hsa-miR-4468	CLIP-seq
MIRT812366	hsa-miR-4493	CLIP-seq
MIRT812367	hsa-miR-4506	CLIP-seq
MIRT812368	hsa-miR-4518	CLIP-seq
MIRT812369	hsa-miR-4793-5p	CLIP-seq
MIRT812370	hsa-miR-544b	CLIP-seq
MIRT812371	hsa-miR-555	CLIP-seq
MIRT812372	hsa-miR-566	CLIP-seq
MIRT1940248	hsa-miR-1827	CLIP-seq
MIRT1940249	hsa-miR-323b-3p	CLIP-seq
MIRT1940250	hsa-miR-4705	CLIP-seq
MIRT812358	hsa-miR-1178	CLIP-seq
MIRT812360	hsa-miR-1266	CLIP-seq
MIRT2179164	hsa-miR-1276	CLIP-seq
MIRT812361	hsa-miR-2115	CLIP-seq
MIRT812362	hsa-miR-4270	CLIP-seq
MIRT812364	hsa-miR-4441	CLIP-seq
MIRT812366	hsa-miR-4493	CLIP-seq
MIRT812368	hsa-miR-4518	CLIP-seq
MIRT812366	hsa-miR-4493	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IEA
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	TAS
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IDA	28420705
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0010025	Process	Wax biosynthetic process	IEA
GO:0010025	Process	Wax biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0036155	Process	Acylglycerol acyl-chain remodeling	TAS
GO:0042572	Process	Retinol metabolic process	IEA
GO:0047196	Function	Long-chain-alcohol O-fatty-acyltransferase activity	EXP	15220349, 15671038, 16106050
GO:0047196	Function	Long-chain-alcohol O-fatty-acyltransferase activity	IEA
GO:0050252	Function	Retinol O-fatty-acyltransferase activity	EXP	15220349, 16106050, 28096191
GO:0050252	Function	Retinol O-fatty-acyltransferase activity	IBA
GO:0050252	Function	Retinol O-fatty-acyltransferase activity	IDA	24799687
GO:0050252	Function	Retinol O-fatty-acyltransferase activity	IEA

MIM	HGNC	e!Ensembl
300925	23251	ENSG00000147160

Q6E213

Protein name

Acyl-CoA wax alcohol acyltransferase 2 (EC 2.3.1.75) (11-cis-specific retinyl-ester synthase) (11-cis-RE-synthase) (Acyl-CoA retinol O-fatty-acyltransferase) (ARAT) (Retinol O-fatty-acyltransferase) (EC 2.3.1.76) (Diacylglycerol O-acyltransferase 2-like p

Protein function

Acyltransferase that catalyzes the formation of ester bonds between fatty alcohols and fatty acyl-CoAs to form wax monoesters (PubMed:15220349, PubMed:15671038, PubMed:16106050, PubMed:28420705). Shows a preference for medium chain acyl-CoAs fro

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03982	DAGAT	38 → 333	Diacylglycerol acyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skin, where it is primarily restricted to undifferentiated peripheral sebocytes. Also expressed at lower level in other tissues except pancreas. {ECO:0000269|PubMed:15220349, ECO:0000269|PubMed:15671038, ECO:0000269

Sequence

MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW
KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF
ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV
IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG
FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV
AKYHTLYIDALRKLFDQHKTKFGISETQELEII

Sequence length

333

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Retinol metabolism	Acyl chain remodeling of DAG and TAG
Metabolic pathways	The retinoid cycle in cones (daylight vision)
Vitamin digestion and absorption	Wax biosynthesis

AWAT2 (acyl-CoA wax alcohol acyltransferase 2)

Save This Analysis