DHRS3 (dehydrogenase/reductase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9249
• Gene name: Dehydrogenase/reductase 3
• Gene symbol: DHRS3
• Synonyms (NCBI Gene): CNALPTC1, DD83.1, RDH17, Rsdr1, SDR1, SDR16C1, retSDR1
• Chromosome: 1
• Chromosome location: 1p36.21
• Summary: Short-chain dehydrogenases/reductases (SDRs), such as DHRS3, catalyze the oxidation/reduction of a wide range of substrates, including retinoids and steroids (Haeseleer and Palczewski, 2000 [PubMed 10800688]).[supplied by OMIM, Jun 2009]

miRNA Show/Hide all (284)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017134	hsa-miR-335-5p	Microarray	18185580
MIRT022260	hsa-miR-124-3p	Microarray	18668037
MIRT049042	hsa-miR-92a-3p	CLASH	23622248
MIRT645338	hsa-miR-4719	HITS-CLIP	23824327
MIRT645337	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645336	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645335	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT645334	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645333	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT732475	hsa-miR-3074-5p	Immunocytochemistry (ICC), Luciferase reporter assay, qRT-PCR, Western blotting	33902658
MIRT732475	hsa-miR-3074-5p	Immunocytochemistry (ICC), Luciferase reporter assay, qRT-PCR, Western blotting	33902658
MIRT732475	hsa-miR-3074-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	33902658
MIRT645338	hsa-miR-4719	HITS-CLIP	23824327
MIRT645337	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645336	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645335	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT645334	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645333	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT934937	hsa-miR-1343	CLIP-seq
MIRT934938	hsa-miR-1910	CLIP-seq
MIRT934939	hsa-miR-1914	CLIP-seq
MIRT934940	hsa-miR-19a	CLIP-seq
MIRT934941	hsa-miR-19b	CLIP-seq
MIRT934942	hsa-miR-223	CLIP-seq
MIRT934943	hsa-miR-3144-3p	CLIP-seq
MIRT934944	hsa-miR-3151	CLIP-seq
MIRT934945	hsa-miR-339-5p	CLIP-seq
MIRT934946	hsa-miR-4447	CLIP-seq
MIRT934947	hsa-miR-4472	CLIP-seq
MIRT934948	hsa-miR-455-3p	CLIP-seq
MIRT934949	hsa-miR-491-5p	CLIP-seq
MIRT934950	hsa-miR-518a-5p	CLIP-seq
MIRT934951	hsa-miR-527	CLIP-seq
MIRT934952	hsa-miR-935	CLIP-seq
MIRT934940	hsa-miR-19a	CLIP-seq
MIRT934941	hsa-miR-19b	CLIP-seq
MIRT2212140	hsa-miR-2113	CLIP-seq
MIRT934937	hsa-miR-1343	CLIP-seq
MIRT2386883	hsa-miR-193a-3p	CLIP-seq
MIRT2386884	hsa-miR-193b	CLIP-seq
MIRT934940	hsa-miR-19a	CLIP-seq
MIRT934941	hsa-miR-19b	CLIP-seq
MIRT2386885	hsa-miR-3136-3p	CLIP-seq
MIRT2386886	hsa-miR-3199	CLIP-seq
MIRT2386887	hsa-miR-4515	CLIP-seq
MIRT934950	hsa-miR-518a-5p	CLIP-seq
MIRT934951	hsa-miR-527	CLIP-seq
MIRT2436809	hsa-miR-1178	CLIP-seq
MIRT2436810	hsa-miR-1915	CLIP-seq
MIRT2436811	hsa-miR-28-5p	CLIP-seq
MIRT2436812	hsa-miR-298	CLIP-seq
MIRT2386885	hsa-miR-3136-3p	CLIP-seq
MIRT2436813	hsa-miR-3139	CLIP-seq
MIRT2436814	hsa-miR-3144-5p	CLIP-seq
MIRT2436815	hsa-miR-3191	CLIP-seq
MIRT2436816	hsa-miR-3690	CLIP-seq
MIRT2436817	hsa-miR-370	CLIP-seq
MIRT2436818	hsa-miR-4254	CLIP-seq
MIRT2436819	hsa-miR-4320	CLIP-seq
MIRT2436820	hsa-miR-4530	CLIP-seq
MIRT2436821	hsa-miR-4652-5p	CLIP-seq
MIRT2436822	hsa-miR-4663	CLIP-seq
MIRT2436823	hsa-miR-4667-3p	CLIP-seq
MIRT2436824	hsa-miR-4667-5p	CLIP-seq
MIRT2436825	hsa-miR-4688	CLIP-seq
MIRT2436826	hsa-miR-4700-5p	CLIP-seq
MIRT2436827	hsa-miR-4731-5p	CLIP-seq
MIRT2436828	hsa-miR-486-3p	CLIP-seq
MIRT2436829	hsa-miR-501-3p	CLIP-seq
MIRT2436830	hsa-miR-502-3p	CLIP-seq
MIRT2436831	hsa-miR-522	CLIP-seq
MIRT2436832	hsa-miR-601	CLIP-seq
MIRT2436833	hsa-miR-639	CLIP-seq
MIRT2436834	hsa-miR-708	CLIP-seq
MIRT2436835	hsa-miR-767-3p	CLIP-seq
MIRT2436836	hsa-miR-875-3p	CLIP-seq
MIRT2436837	hsa-miR-922	CLIP-seq
MIRT2436810	hsa-miR-1915	CLIP-seq
MIRT2436811	hsa-miR-28-5p	CLIP-seq
MIRT2386885	hsa-miR-3136-3p	CLIP-seq
MIRT2436813	hsa-miR-3139	CLIP-seq
MIRT2436814	hsa-miR-3144-5p	CLIP-seq
MIRT2436815	hsa-miR-3191	CLIP-seq
MIRT2436819	hsa-miR-4320	CLIP-seq
MIRT2436821	hsa-miR-4652-5p	CLIP-seq
MIRT2436824	hsa-miR-4667-5p	CLIP-seq
MIRT2436825	hsa-miR-4688	CLIP-seq
MIRT2436826	hsa-miR-4700-5p	CLIP-seq
MIRT2436827	hsa-miR-4731-5p	CLIP-seq
MIRT2436828	hsa-miR-486-3p	CLIP-seq
MIRT2436833	hsa-miR-639	CLIP-seq
MIRT2436834	hsa-miR-708	CLIP-seq
MIRT2436809	hsa-miR-1178	CLIP-seq
MIRT2515886	hsa-miR-1185	CLIP-seq
MIRT2515887	hsa-miR-1253	CLIP-seq
MIRT2515888	hsa-miR-1255a	CLIP-seq
MIRT2515889	hsa-miR-1255b	CLIP-seq
MIRT2515890	hsa-miR-1298	CLIP-seq
MIRT934937	hsa-miR-1343	CLIP-seq
MIRT2515891	hsa-miR-139-5p	CLIP-seq
MIRT2515892	hsa-miR-149	CLIP-seq
MIRT2515893	hsa-miR-151-3p	CLIP-seq
MIRT2515894	hsa-miR-1827	CLIP-seq
MIRT934938	hsa-miR-1910	CLIP-seq
MIRT934939	hsa-miR-1914	CLIP-seq
MIRT2436810	hsa-miR-1915	CLIP-seq
MIRT2386883	hsa-miR-193a-3p	CLIP-seq
MIRT2386884	hsa-miR-193b	CLIP-seq
MIRT934940	hsa-miR-19a	CLIP-seq
MIRT934941	hsa-miR-19b	CLIP-seq
MIRT2212140	hsa-miR-2113	CLIP-seq
MIRT934942	hsa-miR-223	CLIP-seq
MIRT2515895	hsa-miR-2467-5p	CLIP-seq
MIRT2436811	hsa-miR-28-5p	CLIP-seq
MIRT2436812	hsa-miR-298	CLIP-seq
MIRT2515896	hsa-miR-3064-5p	CLIP-seq
MIRT2386885	hsa-miR-3136-3p	CLIP-seq
MIRT2436813	hsa-miR-3139	CLIP-seq
MIRT934943	hsa-miR-3144-3p	CLIP-seq
MIRT2436814	hsa-miR-3144-5p	CLIP-seq
MIRT934944	hsa-miR-3151	CLIP-seq
MIRT2515897	hsa-miR-3188	CLIP-seq
MIRT2436815	hsa-miR-3191	CLIP-seq
MIRT2386886	hsa-miR-3199	CLIP-seq
MIRT934945	hsa-miR-339-5p	CLIP-seq
MIRT2515898	hsa-miR-3605-3p	CLIP-seq
MIRT2515899	hsa-miR-3605-5p	CLIP-seq
MIRT2515900	hsa-miR-3612	CLIP-seq
MIRT2515901	hsa-miR-3650	CLIP-seq
MIRT2515902	hsa-miR-3679-5p	CLIP-seq
MIRT2436816	hsa-miR-3690	CLIP-seq
MIRT2436817	hsa-miR-370	CLIP-seq
MIRT2515903	hsa-miR-3907	CLIP-seq
MIRT2515904	hsa-miR-3975	CLIP-seq
MIRT2515905	hsa-miR-423-3p	CLIP-seq
MIRT2436818	hsa-miR-4254	CLIP-seq
MIRT2515906	hsa-miR-4268	CLIP-seq
MIRT2436819	hsa-miR-4320	CLIP-seq
MIRT2515907	hsa-miR-4421	CLIP-seq
MIRT934946	hsa-miR-4447	CLIP-seq
MIRT2515908	hsa-miR-4455	CLIP-seq
MIRT934947	hsa-miR-4472	CLIP-seq
MIRT2515909	hsa-miR-4481	CLIP-seq
MIRT2386887	hsa-miR-4515	CLIP-seq
MIRT2515910	hsa-miR-4520a-3p	CLIP-seq
MIRT2436820	hsa-miR-4530	CLIP-seq
MIRT934948	hsa-miR-455-3p	CLIP-seq
MIRT2515911	hsa-miR-4649-3p	CLIP-seq
MIRT2436821	hsa-miR-4652-5p	CLIP-seq
MIRT2436822	hsa-miR-4663	CLIP-seq
MIRT2436823	hsa-miR-4667-3p	CLIP-seq
MIRT2436824	hsa-miR-4667-5p	CLIP-seq
MIRT2515912	hsa-miR-4687-3p	CLIP-seq
MIRT2436825	hsa-miR-4688	CLIP-seq
MIRT2436826	hsa-miR-4700-5p	CLIP-seq
MIRT2515913	hsa-miR-4722-3p	CLIP-seq
MIRT2515914	hsa-miR-4726-3p	CLIP-seq
MIRT2436827	hsa-miR-4731-5p	CLIP-seq
MIRT2515915	hsa-miR-4745-5p	CLIP-seq
MIRT2515916	hsa-miR-4758-5p	CLIP-seq
MIRT2515917	hsa-miR-4761-5p	CLIP-seq
MIRT2515918	hsa-miR-4793-5p	CLIP-seq
MIRT2515919	hsa-miR-4794	CLIP-seq
MIRT2515920	hsa-miR-485-5p	CLIP-seq
MIRT2436828	hsa-miR-486-3p	CLIP-seq
MIRT934949	hsa-miR-491-5p	CLIP-seq
MIRT2436829	hsa-miR-501-3p	CLIP-seq
MIRT2436830	hsa-miR-502-3p	CLIP-seq
MIRT934950	hsa-miR-518a-5p	CLIP-seq
MIRT2436831	hsa-miR-522	CLIP-seq
MIRT934951	hsa-miR-527	CLIP-seq
MIRT2515921	hsa-miR-548t	CLIP-seq
MIRT2515922	hsa-miR-552	CLIP-seq
MIRT2515923	hsa-miR-580	CLIP-seq
MIRT2436832	hsa-miR-601	CLIP-seq
MIRT2515924	hsa-miR-618	CLIP-seq
MIRT2515925	hsa-miR-629	CLIP-seq
MIRT2515926	hsa-miR-637	CLIP-seq
MIRT2436833	hsa-miR-639	CLIP-seq
MIRT2515927	hsa-miR-650	CLIP-seq
MIRT2515928	hsa-miR-660	CLIP-seq
MIRT2515929	hsa-miR-663b	CLIP-seq
MIRT2436834	hsa-miR-708	CLIP-seq
MIRT2515930	hsa-miR-764	CLIP-seq
MIRT2436835	hsa-miR-767-3p	CLIP-seq
MIRT2436836	hsa-miR-875-3p	CLIP-seq
MIRT2436837	hsa-miR-922	CLIP-seq
MIRT934952	hsa-miR-935	CLIP-seq
MIRT2436809	hsa-miR-1178	CLIP-seq
MIRT2515886	hsa-miR-1185	CLIP-seq
MIRT2515887	hsa-miR-1253	CLIP-seq
MIRT2515888	hsa-miR-1255a	CLIP-seq
MIRT2515889	hsa-miR-1255b	CLIP-seq
MIRT2515890	hsa-miR-1298	CLIP-seq
MIRT934937	hsa-miR-1343	CLIP-seq
MIRT2515891	hsa-miR-139-5p	CLIP-seq
MIRT2515892	hsa-miR-149	CLIP-seq
MIRT2515893	hsa-miR-151-3p	CLIP-seq
MIRT2515894	hsa-miR-1827	CLIP-seq
MIRT934938	hsa-miR-1910	CLIP-seq
MIRT934939	hsa-miR-1914	CLIP-seq
MIRT2436810	hsa-miR-1915	CLIP-seq
MIRT2386883	hsa-miR-193a-3p	CLIP-seq
MIRT2386884	hsa-miR-193b	CLIP-seq
MIRT934940	hsa-miR-19a	CLIP-seq
MIRT934941	hsa-miR-19b	CLIP-seq
MIRT2212140	hsa-miR-2113	CLIP-seq
MIRT934942	hsa-miR-223	CLIP-seq
MIRT2515895	hsa-miR-2467-5p	CLIP-seq
MIRT2436811	hsa-miR-28-5p	CLIP-seq
MIRT2436812	hsa-miR-298	CLIP-seq
MIRT2515896	hsa-miR-3064-5p	CLIP-seq
MIRT2386885	hsa-miR-3136-3p	CLIP-seq
MIRT2436813	hsa-miR-3139	CLIP-seq
MIRT934943	hsa-miR-3144-3p	CLIP-seq
MIRT2436814	hsa-miR-3144-5p	CLIP-seq
MIRT934944	hsa-miR-3151	CLIP-seq
MIRT2515897	hsa-miR-3188	CLIP-seq
MIRT2436815	hsa-miR-3191	CLIP-seq
MIRT2386886	hsa-miR-3199	CLIP-seq
MIRT934945	hsa-miR-339-5p	CLIP-seq
MIRT2515898	hsa-miR-3605-3p	CLIP-seq
MIRT2515899	hsa-miR-3605-5p	CLIP-seq
MIRT2515900	hsa-miR-3612	CLIP-seq
MIRT2515901	hsa-miR-3650	CLIP-seq
MIRT2515902	hsa-miR-3679-5p	CLIP-seq
MIRT2436816	hsa-miR-3690	CLIP-seq
MIRT2436817	hsa-miR-370	CLIP-seq
MIRT2515903	hsa-miR-3907	CLIP-seq
MIRT2515904	hsa-miR-3975	CLIP-seq
MIRT2515905	hsa-miR-423-3p	CLIP-seq
MIRT2436818	hsa-miR-4254	CLIP-seq
MIRT2515906	hsa-miR-4268	CLIP-seq
MIRT2436819	hsa-miR-4320	CLIP-seq
MIRT2515907	hsa-miR-4421	CLIP-seq
MIRT934946	hsa-miR-4447	CLIP-seq
MIRT2515908	hsa-miR-4455	CLIP-seq
MIRT934947	hsa-miR-4472	CLIP-seq
MIRT2515909	hsa-miR-4481	CLIP-seq
MIRT2386887	hsa-miR-4515	CLIP-seq
MIRT2515910	hsa-miR-4520a-3p	CLIP-seq
MIRT2436820	hsa-miR-4530	CLIP-seq
MIRT934948	hsa-miR-455-3p	CLIP-seq
MIRT2515911	hsa-miR-4649-3p	CLIP-seq
MIRT2436821	hsa-miR-4652-5p	CLIP-seq
MIRT2436822	hsa-miR-4663	CLIP-seq
MIRT2436823	hsa-miR-4667-3p	CLIP-seq
MIRT2436824	hsa-miR-4667-5p	CLIP-seq
MIRT2515912	hsa-miR-4687-3p	CLIP-seq
MIRT2436825	hsa-miR-4688	CLIP-seq
MIRT2436826	hsa-miR-4700-5p	CLIP-seq
MIRT2515913	hsa-miR-4722-3p	CLIP-seq
MIRT2515914	hsa-miR-4726-3p	CLIP-seq
MIRT2436827	hsa-miR-4731-5p	CLIP-seq
MIRT2515915	hsa-miR-4745-5p	CLIP-seq
MIRT2515916	hsa-miR-4758-5p	CLIP-seq
MIRT2515917	hsa-miR-4761-5p	CLIP-seq
MIRT2515918	hsa-miR-4793-5p	CLIP-seq
MIRT2515919	hsa-miR-4794	CLIP-seq
MIRT2515920	hsa-miR-485-5p	CLIP-seq
MIRT2436828	hsa-miR-486-3p	CLIP-seq
MIRT934949	hsa-miR-491-5p	CLIP-seq
MIRT2436829	hsa-miR-501-3p	CLIP-seq
MIRT2436830	hsa-miR-502-3p	CLIP-seq
MIRT934950	hsa-miR-518a-5p	CLIP-seq
MIRT2436831	hsa-miR-522	CLIP-seq
MIRT934951	hsa-miR-527	CLIP-seq
MIRT2515921	hsa-miR-548t	CLIP-seq
MIRT2515922	hsa-miR-552	CLIP-seq
MIRT2515923	hsa-miR-580	CLIP-seq
MIRT2436832	hsa-miR-601	CLIP-seq
MIRT2515924	hsa-miR-618	CLIP-seq
MIRT2515925	hsa-miR-629	CLIP-seq
MIRT2515926	hsa-miR-637	CLIP-seq
MIRT2436833	hsa-miR-639	CLIP-seq
MIRT2515927	hsa-miR-650	CLIP-seq
MIRT2515928	hsa-miR-660	CLIP-seq
MIRT2515929	hsa-miR-663b	CLIP-seq
MIRT2436834	hsa-miR-708	CLIP-seq
MIRT2515930	hsa-miR-764	CLIP-seq
MIRT2436835	hsa-miR-767-3p	CLIP-seq
MIRT2436836	hsa-miR-875-3p	CLIP-seq
MIRT2436837	hsa-miR-922	CLIP-seq
MIRT934952	hsa-miR-935	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	9705317
GO:0001523	Process	Retinoid metabolic process	IBA
GO:0001523	Process	Retinoid metabolic process	IEA
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IBA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005811	Component	Lipid droplet	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007601	Process	Visual perception	TAS	9705317
GO:0009055	Function	Electron transfer activity	TAS	9705317
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030278	Process	Regulation of ossification	IEA
GO:0042572	Process	Retinol metabolic process	TAS	9705317
GO:0042622	Component	Photoreceptor outer segment membrane	TAS
GO:0048385	Process	Regulation of retinoic acid receptor signaling pathway	IBA
GO:0048387	Process	Negative regulation of retinoic acid receptor signaling pathway	IEA
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IEA
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	TAS
GO:0060021	Process	Roof of mouth development	IEA
GO:0060349	Process	Bone morphogenesis	IEA
GO:0060411	Process	Cardiac septum morphogenesis	IEA

Other IDs

• MIM: 612830
• HGNC: 17693
• e!Ensembl: ENSG00000162496

Protein

• UniProt ID: O75911
• Protein name: Short-chain dehydrogenase/reductase 3 (EC 1.1.1.300) (DD83.1) (Retinal short-chain dehydrogenase/reductase 1) (retSDR1) (Retinol dehydrogenase 17) (Short chain dehydrogenase/reductase family 16C member 1)
• Protein function: Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00106	adh_short	39 → 233	short chain dehydrogenase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels found in heart, placenta, lung, liver, kidney, pancreas, thyroid, testis, stomach, trachea and spinal cord. Lower levels found in skeletal muscle, intestine and lymph node. No expression detected in
• Sequence:

  MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE
  RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL
  VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
  AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
  LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG
  RT

• Sequence length: 302

Pathways

KEGG Pathway	Reactome Pathway
Retinol metabolism	The retinoid cycle in cones (daylight vision)
Metabolic pathways	RA biosynthesis pathway
Biosynthesis of cofactors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CRANIOSYNOSTOSIS	—	Disgenet, GenCC Disgenet, GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DHRS3-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (16)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ADULT SYNDROME	ADULT Syndrome	BEFREE	20543567		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18854940	Associate	★☆☆☆☆ Found in Text Mining only
ENDPLATE ACETYLCHOLINESTERASE DEFICIENCY (disorder)	Endplate acetylcholinesterase deficiency	BEFREE	30486871		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30758105	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11861404, 21659514		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20543567		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11861404		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21314941, 36231133	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21659514		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33691763	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18676742		★☆☆☆☆ Found in Text Mining only
Rudiger syndrome 1	Rudiger syndrome	BEFREE	20543567		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37951921	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	18676742	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18676742		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30486871		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RDH13 3 shared pathwaysRetinol metabolism, Biosynthesis of cofactors, RA biosynthesis pathway Related via 3 shared pathways including Retinol metabolism, Biosynthesis of cofactors. SDR16C5 3 shared pathwaysRetinol metabolism, Biosynthesis of cofactors, RA biosynthesis pathway Related via 3 shared pathways including Retinol metabolism, Biosynthesis of cofactors. ALDH1A3 2 shared pathwaysRetinol metabolism, RA biosynthesis pathway Related via 2 shared pathways including Retinol metabolism, RA biosynthesis pathway. RDH11 3 shared pathwaysRetinol metabolism, Biosynthesis of cofactors, RA biosynthesis pathway Related via 3 shared pathways including Retinol metabolism, Biosynthesis of cofactors. ALDH1A2 2 shared pathwaysRetinol metabolism, RA biosynthesis pathway Related via 2 shared pathways including Retinol metabolism, RA biosynthesis pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RDH13	0	[]	3	["Retinol metabolism","Biosynthesis of cofactors","RA biosynthesis pathway"]	0	[]
SDR16C5	0	[]	3	["Retinol metabolism","Biosynthesis of cofactors","RA biosynthesis pathway"]	0	[]
ALDH1A3	0	[]	2	["Retinol metabolism","RA biosynthesis pathway"]	0	[]
RDH11	0	[]	3	["Retinol metabolism","Biosynthesis of cofactors","RA biosynthesis pathway"]	0	[]
ALDH1A2	0	[]	2	["Retinol metabolism","RA biosynthesis pathway"]	0	[]

Diseases Linked via Similar Genes

Scoliosis Linked via 2 of 5 related genesSDR16C5, ALDH1A2 Aortic disease Linked via 1 of 5 related genesRDH13 Necrosis Linked via 1 of 5 related genesRDH13 Cervical cancer Linked via 1 of 5 related genesSDR16C5 Autism Linked via 1 of 5 related genesALDH1A3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Scoliosis	2	["SDR16C5","ALDH1A2"]
Aortic disease	1	["RDH13"]
Necrosis	1	["RDH13"]
Cervical cancer	1	["SDR16C5"]
Autism	1	["ALDH1A3"]