Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	11101
Gene name	Arginyltransferase 1
Gene symbol	ATE1
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q26.13
Summary	This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin

44 Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018958	hsa-miR-335-5p	Microarray	18185580
MIRT020247	hsa-miR-130b-3p	Sequencing	20371350
MIRT051987	hsa-let-7b-5p	CLASH	23622248
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804136	hsa-miR-141	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804138	hsa-miR-186	CLIP-seq
MIRT804139	hsa-miR-194	CLIP-seq
MIRT804140	hsa-miR-200a	CLIP-seq
MIRT804141	hsa-miR-219-1-3p	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804146	hsa-miR-3065-3p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT804148	hsa-miR-3662	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804150	hsa-miR-4682	CLIP-seq
MIRT804151	hsa-miR-4691-5p	CLIP-seq
MIRT804152	hsa-miR-4698	CLIP-seq
MIRT804153	hsa-miR-4719	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804155	hsa-miR-571	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq
MIRT1937493	hsa-miR-2355-5p	CLIP-seq
MIRT804147	hsa-miR-3143	CLIP-seq
MIRT1937494	hsa-miR-3713	CLIP-seq
MIRT1937495	hsa-miR-3924	CLIP-seq
MIRT1937496	hsa-miR-4427	CLIP-seq
MIRT1937497	hsa-miR-4724-5p	CLIP-seq
MIRT804154	hsa-miR-543	CLIP-seq
MIRT804145	hsa-miR-2467-3p	CLIP-seq
MIRT804149	hsa-miR-4257	CLIP-seq
MIRT804156	hsa-miR-873	CLIP-seq
MIRT804135	hsa-miR-1271	CLIP-seq
MIRT804137	hsa-miR-182	CLIP-seq
MIRT804142	hsa-miR-23a	CLIP-seq
MIRT804143	hsa-miR-23b	CLIP-seq
MIRT804144	hsa-miR-23c	CLIP-seq
MIRT804157	hsa-miR-885-3p	CLIP-seq
MIRT804158	hsa-miR-96	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IBA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IDA	34893540
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	IEA
GO:0004057	Function	Arginyl-tRNA--protein transferase activity	TAS	9858543
GO:0005515	Function	Protein binding	IPI	23455924, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	9858543
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9858543
GO:0005737	Component	Cytoplasm	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0006979	Process	Response to oxidative stress	IDA	34893540
GO:0010498	Process	Proteasomal protein catabolic process	IBA
GO:0010498	Process	Proteasomal protein catabolic process	IMP	25970626
GO:0016598	Process	Protein arginylation	NAS	9858543
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0044314	Process	Protein K27-linked ubiquitination	IDA	34893540
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	34893540
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	34893540
GO:0071596	Process	Ubiquitin-dependent protein catabolic process via the N-end rule pathway	IDA	34893540

MIM	HGNC	e!Ensembl
607103	782	ENSG00000107669

O95260

Protein name

Arginyl-tRNA--protein transferase 1 (Arginyltransferase 1) (R-transferase 1) (EC 2.3.2.8) (Arginine-tRNA--protein transferase 1)

Protein function

Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein (PubMed:34893540). This arginylation is required for degradation of the protein via the ubiquitin pathway (PubMed:34893540). Does no

PDB

8TZV , 8UAU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04376	ATE_N	21 → 92	Arginine-tRNA-protein transferase, N terminus	Family
PF04377	ATE_C	290 → 429	Arginine-tRNA-protein transferase, C terminus	Family

Sequence

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGK
YVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
DDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSG
EPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPS
LFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQM
VIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILP
NCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIM
PYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN

Sequence length

518

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (20)
ATE1-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	21263130, 29059683, 32887889, 34290314, 38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	21263130, 29059683, 32887889, 34290314, 38538606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	37196047	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	28886342, 38172110, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	37380357	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38632662	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	32887889, 38632662	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	32887889	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Alzheimer Disease	Alzheimer disease	Pubtator	33687501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33687501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25381249, 31125336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36635225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	26114870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30177837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29916141, 30177837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35561126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30177837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31446431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30177837		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ATE1 (arginyltransferase 1)

Bookmark This Gene