ASPDH (aspartate dehydrogenase domain containing)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 554235
Gene name Aspartate dehydrogenase domain containing
Gene symbol ASPDH
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.33
miRNA miRNA information provided by mirtarbase database.
11 Show/Hide all (11)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT803106 hsa-miR-2110 CLIP-seq
MIRT803107 hsa-miR-3151 CLIP-seq
MIRT803108 hsa-miR-4271 CLIP-seq
MIRT803109 hsa-miR-4292 CLIP-seq
MIRT803110 hsa-miR-4667-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0009435 Process NAD+ biosynthetic process IEA
GO:0016491 Function Oxidoreductase activity IEA
GO:0033735 Function Aspartate dehydrogenase [NAD(P)+] activity IEA
GO:0050661 Function NADP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6ND91
Protein name Aspartate dehydrogenase domain-containing protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01958 DUF108 169 → 261 Domain of unknown function DUF108 Family
PF03447 NAD_binding_3 13 → 124 Homoserine dehydrogenase, NAD binding domain Domain
Sequence 
MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNL
AALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA
VFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPV
RGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSF
AVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC
Sequence length 283
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of cofactors
Sort by:
NADK2 2 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. NMNAT2 2 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. QPRT 2 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. NMNAT3 2 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors. NADSYN1 2 shared pathwaysNicotinate and nicotinamide metabolism, Biosynthesis of cofactors Related via 2 shared pathways including Nicotinate and nicotinamide metabolism, Biosynthesis of cofactors.
Diabetes mellitus type 2 Linked via 2 of 5 related genesNADK2, NMNAT2 Systemic lupus erythematosus Linked via 2 of 5 related genesNMNAT2, NADSYN1 2,4-dienoyl-coa reductase deficiency Linked via 1 of 5 related genesNADK2 Multinodular goiter Linked via 1 of 5 related genesNADK2 progressive encephalopathy with leukodystrophy due to DECR deficiency Linked via 1 of 5 related genesNADK2