ASIC4 (acid sensing ion channel subunit family member 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55515
Gene name Acid sensing ion channel subunit family member 4
Gene symbol ASIC4
Synonyms (NCBI Gene)
ACCN4BNAC4
Chromosome 2
Chromosome location 2q35
Summary This gene belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. This gene is predom
miRNA miRNA information provided by mirtarbase database.
43 Show/Hide all (43)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018746 hsa-miR-335-5p Microarray 18185580
MIRT713987 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT713986 hsa-miR-2276-5p HITS-CLIP 19536157
MIRT713985 hsa-miR-5088-3p HITS-CLIP 19536157
MIRT713984 hsa-miR-3183 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001662 Process Behavioral fear response IEA
GO:0005272 Function Sodium channel activity IEA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606715 21263 ENSG00000072182
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96FT7
Protein name Acid-sensing ion channel 4 (ASIC4) (Amiloride-sensitive cation channel 4) (Amiloride-sensitive cation channel 4, pituitary)
Protein function Does not exhibit measurable stand-alone pH-gated sodium channel activity but may form pH-gated heterotrimeric sodium channels. Its activity could also depend on alternative gating mechanisms.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00858 ASC 172 → 572 Amiloride-sensitive sodium channel Family
Tissue specificity TISSUE SPECIFICITY: Expressed in pituitary gland. Weakly expressed in brain, vestibular system and organ of Corti. {ECO:0000269|PubMed:10852210}.
Sequence 
MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQR
QHQGCGAAGSGSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALA
SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHG
LGRACGPGPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVAMDPAAPAPVAGFP
AVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQL
ADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQE
EYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCP
TPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRA
AYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGIS
TLGLQELKEQSPCPSRGRVEGGGVSSLLPNHHHPHGPPGGLFEDFAC
Sequence length 647
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Inflammatory mediator regulation of TRP channels Stimuli-sensing channels
Sort by:
ASIC1 2 shared pathwaysInflammatory mediator regulation of TRP channels, Stimuli-sensing channels Related via 2 shared pathways including Inflammatory mediator regulation of TRP channels, Stimuli-sensing channels. ASIC5 2 shared pathwaysInflammatory mediator regulation of TRP channels, Stimuli-sensing channels Related via 2 shared pathways including Inflammatory mediator regulation of TRP channels, Stimuli-sensing channels. ASIC3 2 shared pathwaysInflammatory mediator regulation of TRP channels, Stimuli-sensing channels Related via 2 shared pathways including Inflammatory mediator regulation of TRP channels, Stimuli-sensing channels. ASIC2 2 shared pathwaysInflammatory mediator regulation of TRP channels, Stimuli-sensing channels Related via 2 shared pathways including Inflammatory mediator regulation of TRP channels, Stimuli-sensing channels. CALM1 2 shared pathwaysInflammatory mediator regulation of TRP channels, Stimuli-sensing channels Related via 2 shared pathways including Inflammatory mediator regulation of TRP channels, Stimuli-sensing channels.
Brain injuries Linked via 1 of 5 related genesASIC1 Brain ischemia Linked via 1 of 5 related genesASIC1 Schizophrenia Linked via 1 of 5 related genesASIC1 Diabetic retinopathy Linked via 1 of 5 related genesASIC5 Autism Linked via 1 of 5 related genesASIC2