ASGR1 (asialoglycoprotein receptor 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 432
Gene name Asialoglycoprotein receptor 1
Gene symbol ASGR1
Synonyms (NCBI Gene)
ASGPRASGPR1CLEC4H1HL-1
Chromosome 17
Chromosome location 17p13.1
Summary This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed term
miRNA miRNA information provided by mirtarbase database.
31 Show/Hide all (31)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018208 hsa-miR-335-5p Microarray 18185580
MIRT724374 hsa-miR-4668-3p HITS-CLIP 19536157
MIRT724373 hsa-miR-362-5p HITS-CLIP 19536157
MIRT724372 hsa-miR-500b-5p HITS-CLIP 19536157
MIRT724371 hsa-miR-501-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004873 Function Asialoglycoprotein receptor activity IEA
GO:0004873 Function Asialoglycoprotein receptor activity TAS
GO:0005515 Function Protein binding IPI 21988832, 32296183
GO:0005537 Function D-mannose binding IBA
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
108360 742 ENSG00000141505
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P07306
Protein name Asialoglycoprotein receptor 1 (ASGP-R 1) (ASGPR 1) (C-type lectin domain family 4 member H1) (Hepatic lectin H1) (HL-1)
Protein function Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding
PDB 1DV8 , 5JPV , 5JQ1 , 6YAU , 8TS0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 171 → 279 Lectin C-type domain Domain
PF03954 Lectin_N 13 → 144 Family
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively in hepatic parenchymal cells.
Sequence 
MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIG
SQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDH
SSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADN
YCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQ
PDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Virion - Ebolavirus, Lyssavirus and Morbillivirus Asparagine N-linked glycosylation
Thyroid hormone synthesis  
ASGR2 2 shared pathwaysThyroid hormone synthesis, Asparagine N-linked glycosylation Related via 2 shared pathways including Thyroid hormone synthesis, Asparagine N-linked glycosylation.
Congenital heart disease Linked via 1 of 1 related geneASGR2 Hyperlipidemia Linked via 1 of 1 related geneASGR2 Metabolic syndrome Linked via 1 of 1 related geneASGR2