ARMH4 (armadillo like helical domain containing 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 145407
Gene name Armadillo like helical domain containing 4
Gene symbol ARMH4
Synonyms (NCBI Gene)
C14orf37UT2c14_5376
Chromosome 14
Chromosome location 14q23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 33961781
GO:0016020 Component Membrane IDA 36649229
GO:0016020 Component Membrane IEA
GO:0050727 Process Regulation of inflammatory response IDA 36649229
GO:1903939 Process Regulation of TORC2 signaling IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86TY3
Protein name Armadillo-like helical domain-containing protein 4 (Upstream of mTORC2 protein)
Protein function May modulate immune response and may play a role in inflammation (PubMed:36649229). Down-modulates STAT3 signaling throught direct interaction with IL6ST, resulting in the inhibition of phosphorylation of STAT3 at 'Tyr-705' (PubMed:26927669). Ma
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15767 DUF4696 28 → 610 Domain of unknown function (DUF4696) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in podocytes. {ECO:0000269|PubMed:36649229}.
Sequence 
MRGPIVLHICLAFCSLLLFSVATQCLAFPKIERRREIAHVHAEKGQSDKMNTDDLENSSV
TSKQTPQLVVSEDPMMMSAVPSATSLNKAFSINKETQPGQAGLMQTERPGVSTPTESGVP
SAEEVFGSSQPERISPESGLAKAMLTIAITATPSLTVDEKEELLTSTNFQPIVEEITETT
KGFLKYMDNQSFATESQEGVGLGHSPSSYVNTKEMLTTNPKTEKFEADTDHRTTSFPGAE
STAGSEPGSLTPDKEKPSQMTADNTQAAATKQPLETSEYTLSVEPETDSLLGAPEVTVSV
STAVPAASALSDEWDDTKLESVSRIRTPKLGDNEETQVRTEMSQTAQVSHEGMEGGQPWT
EAAQVALGLPEGETHTGTALLIAHGNERSPAFTDQSSFTPTSLMEDMKVSIVNLLQSTGD
FTESTKENDALFFLETTVSVSVYESEADQLLGNTMKDIITQEMTTAVQEPDATLSMVTQE
QVATLELIRDSGKTEEEKEDPSPVSDVPGVTQLSRRWEPLATTISTTVVPLSFEVTPTVE
EQMDTVTGPNEEFTPVLGSPVTPPGIMVGEPSISPALPALEASSERRTVVPSITRVNTAA
SYGLDQLESEEGQEDEDEEDEEDEDEEEEDEEEDEEDKDADSLDEGLDGDTELPGFTLPG
ITSQEPGLEEGNMDLLEGATYQVPDALEWEQQNQGLVRSWMEKLKDKAGYMSGMLVPVGV
GIAGALFILGALYSIKVMNRRRRNGFKRHKRKQREFNSMQDRVMLLADSSEDEF
Sequence length 774
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (9)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER'S DISEASE NEUROPATHOLOGIC CHANGE — GWAS catalog 25188341
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEMENTIA — GWAS catalog 25188341
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS — GWAS catalog 24925725
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER — GWAS catalog 34294844, 35115687
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION — GWAS catalog 33532862, 38072966
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Multiple Myeloma Multiple myeloma BEFREE 26927669
★★★★★
★☆☆☆☆
Found in Text Mining only
PROTEASOME-ASSOCIATED AUTOINFLAMMATORY SYNDROME 1, DIGENIC Proteasome-associated autoinflammatory syndrome, digenic CLINVAR_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CTLA4 2 shared diseasesLupus nephritis, Non-melanoma skin carcinoma 1 shared evidence sourceGWAS catalog (Non-melanoma skin carcinoma) Related via 2 shared diseases including Lupus nephritis, Non-melanoma skin carcinoma — evidence mostly GWAS catalog. HLA-DQB1 2 shared diseasesLupus nephritis, Non-melanoma skin carcinoma 2 shared evidence sourcesGWAS catalog (Lupus nephritis), GWAS catalog (Non-melanoma skin carcinoma) Related via 2 shared diseases including Lupus nephritis, Non-melanoma skin carcinoma — evidence mostly GWAS catalog. HLA-DRB1 2 shared diseasesLupus nephritis, Non-melanoma skin carcinoma 1 shared evidence sourceGWAS catalog (Non-melanoma skin carcinoma) Related via 2 shared diseases including Lupus nephritis, Non-melanoma skin carcinoma — evidence mostly GWAS catalog. HLA-DQA1 2 shared diseasesLupus nephritis, Non-melanoma skin carcinoma 1 shared evidence sourceGWAS catalog (Non-melanoma skin carcinoma) Related via 2 shared diseases including Lupus nephritis, Non-melanoma skin carcinoma — evidence mostly GWAS catalog.
Ankylosing spondylitis Linked via 4 of 4 related genesCTLA4, HLA-DQB1, HLA-DRB1, HLA-DQA1 Rheumatoid arthritis Linked via 4 of 4 related genesCTLA4, HLA-DQB1, HLA-DRB1, HLA-DQA1 Asthma Linked via 4 of 4 related genesCTLA4, HLA-DQB1, HLA-DRB1, HLA-DQA1 Autoimmune hepatitis Linked via 4 of 4 related genesCTLA4, HLA-DQB1, HLA-DRB1, HLA-DQA1 Autoimmune thyroid disease Linked via 4 of 4 related genesCTLA4, HLA-DQB1, HLA-DRB1, HLA-DQA1