Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	54622
Gene name	ARF like GTPase 15
Gene symbol	ARL15
Synonyms (NCBI Gene)	ARFRP2
Chromosome	5
Chromosome location	5q11.2

114 Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005226	hsa-let-7b-5p	pSILAC	18668040
MIRT016085	hsa-miR-744-5p	Sequencing	20371350
MIRT020858	hsa-miR-155-5p	Proteomics	18668040
MIRT020858	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT021621	hsa-miR-142-3p	Microarray	17612493
MIRT025799	hsa-miR-7-5p	Sequencing	20371350
MIRT005226	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT450971	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT450970	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT450971	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT450970	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT797551	hsa-miR-1252	CLIP-seq
MIRT797552	hsa-miR-140-5p	CLIP-seq
MIRT797553	hsa-miR-186	CLIP-seq
MIRT797554	hsa-miR-30a	CLIP-seq
MIRT797555	hsa-miR-30b	CLIP-seq
MIRT797556	hsa-miR-30c	CLIP-seq
MIRT797557	hsa-miR-30d	CLIP-seq
MIRT797558	hsa-miR-30e	CLIP-seq
MIRT797559	hsa-miR-3123	CLIP-seq
MIRT797560	hsa-miR-3133	CLIP-seq
MIRT797561	hsa-miR-3545-5p	CLIP-seq
MIRT797562	hsa-miR-3919	CLIP-seq
MIRT797563	hsa-miR-4271	CLIP-seq
MIRT797564	hsa-miR-4460	CLIP-seq
MIRT797565	hsa-miR-4706	CLIP-seq
MIRT797566	hsa-miR-4725-3p	CLIP-seq
MIRT797567	hsa-miR-4727-3p	CLIP-seq
MIRT797568	hsa-miR-4749-5p	CLIP-seq
MIRT797569	hsa-miR-744	CLIP-seq
MIRT1935537	hsa-miR-139-5p	CLIP-seq
MIRT1935538	hsa-miR-3682-3p	CLIP-seq
MIRT1935539	hsa-miR-4768-5p	CLIP-seq
MIRT1935540	hsa-miR-4778-5p	CLIP-seq
MIRT1935541	hsa-miR-511	CLIP-seq
MIRT2175613	hsa-miR-3125	CLIP-seq
MIRT2175614	hsa-miR-3662	CLIP-seq
MIRT2175615	hsa-miR-3916	CLIP-seq
MIRT2175616	hsa-miR-4760-3p	CLIP-seq
MIRT1935539	hsa-miR-4768-5p	CLIP-seq
MIRT2443969	hsa-miR-1178	CLIP-seq
MIRT2443970	hsa-miR-3907	CLIP-seq
MIRT2443971	hsa-miR-4670-3p	CLIP-seq
MIRT2443969	hsa-miR-1178	CLIP-seq
MIRT2478867	hsa-miR-1207-5p	CLIP-seq
MIRT2478868	hsa-miR-1245b-3p	CLIP-seq
MIRT2478869	hsa-miR-1253	CLIP-seq
MIRT2478870	hsa-miR-183	CLIP-seq
MIRT2478871	hsa-miR-3152-5p	CLIP-seq
MIRT2478872	hsa-miR-380	CLIP-seq
MIRT2443970	hsa-miR-3907	CLIP-seq
MIRT2478873	hsa-miR-3942-3p	CLIP-seq
MIRT2478874	hsa-miR-4289	CLIP-seq
MIRT2478875	hsa-miR-4311	CLIP-seq
MIRT2478876	hsa-miR-4736	CLIP-seq
MIRT2478877	hsa-miR-4763-3p	CLIP-seq
MIRT1935539	hsa-miR-4768-5p	CLIP-seq
MIRT2478878	hsa-miR-494	CLIP-seq
MIRT1935541	hsa-miR-511	CLIP-seq
MIRT2478879	hsa-miR-570	CLIP-seq
MIRT2478880	hsa-miR-590-3p	CLIP-seq
MIRT2478868	hsa-miR-1245b-3p	CLIP-seq
MIRT2478869	hsa-miR-1253	CLIP-seq
MIRT2478872	hsa-miR-380	CLIP-seq
MIRT2478873	hsa-miR-3942-3p	CLIP-seq
MIRT2478874	hsa-miR-4289	CLIP-seq
MIRT2478875	hsa-miR-4311	CLIP-seq
MIRT2478878	hsa-miR-494	CLIP-seq
MIRT1935541	hsa-miR-511	CLIP-seq
MIRT2478879	hsa-miR-570	CLIP-seq

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003674	Function	Molecular_function	ND
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 32296183
GO:0005525	Function	GTP binding	IEA
GO:0008150	Process	Biological_process	ND
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NXU5

Protein name

ADP-ribosylation factor-like protein 15 (ADP-ribosylation factor-related protein 2) (ARF-related protein 2)

PDB

8F6D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00025	Arf	27 → 194	ADP-ribosylation factor family	Domain

Sequence

MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNV
VSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAAR
NELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDM
DALKDSFSQLINLLEEKDHEAVRM

Sequence length

204

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (17)
ARL15-related disorder	Uncertain significance; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT'S ESOPHAGUS	—	GWAS catalog	35882562	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 35915156	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	35882562	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33356394, 39406924	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	35047847	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	23918589	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	36738649	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	24509480, 28869590, 30054458, 30297969, 30718926, 32341051, 32541925, 33619380, 34594039, 35551307, 36738649, 38374256, 38685053, 39024449, 39349817, 39379762	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (22)
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23918589, 34187973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37551622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36302536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21036322, 30682341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21036322		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	20011104, 21036322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28322786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27554474	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28322786		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24688318, 25799151, 27554474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20011104, 27115357, 30130595, 30682341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	24509480, 28869590, 30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	24509480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31623319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	29242557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29242557, 29465355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18485879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31623319, 33983957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31623319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23918589, 29465355		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ARL15 (ARF like GTPase 15)

Bookmark This Gene