APAF1 (apoptotic peptidase activating factor 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 317
• Gene name: Apoptotic peptidase activating factor 1
• Gene symbol: APAF1
• Synonyms (NCBI Gene): APAF-1, CED4
• Chromosome: 12
• Chromosome location: 12q23.1
• Summary: This gene encodes a cytoplasmic protein that initiates apoptosis. This protein contains several copies of the WD-40 domain, a caspase recruitment domain (CARD), and an ATPase domain (NB-ARC). Upon binding cytochrome c and dATP, this protein forms an oligo

miRNA Show/Hide all (491)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	18829576
MIRT018166	hsa-miR-335-5p	Microarray	18185580
MIRT020853	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT002410	hsa-miR-21-5p	Microarray	18591254
MIRT053424	hsa-miR-624-3p	Microarray	23807165
MIRT054353	hsa-miR-221-3p	Luciferase reporter assay, QRTPCR, Western blot	23630541
MIRT054514	hsa-miR-23a-3p	Luciferase reporter assay, Wetsern blot	24952592
MIRT705610	hsa-miR-302f	HITS-CLIP	23313552
MIRT457990	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT457991	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT457989	hsa-miR-940	HITS-CLIP	23313552
MIRT705609	hsa-miR-3929	HITS-CLIP	23313552
MIRT705608	hsa-miR-4419b	HITS-CLIP	23313552
MIRT705607	hsa-miR-4478	HITS-CLIP	23313552
MIRT705606	hsa-miR-5588-3p	HITS-CLIP	23313552
MIRT705605	hsa-miR-2114-5p	HITS-CLIP	23313552
MIRT705604	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT705603	hsa-miR-5690	HITS-CLIP	23313552
MIRT705602	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT705601	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT457984	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT705600	hsa-miR-20b-3p	HITS-CLIP	23313552
MIRT705599	hsa-miR-219b-3p	HITS-CLIP	23313552
MIRT457982	hsa-miR-1827	HITS-CLIP	23313552
MIRT457981	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT705598	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT705597	hsa-miR-933	HITS-CLIP	23313552
MIRT705596	hsa-miR-7977	HITS-CLIP	23313552
MIRT705595	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT457979	hsa-miR-1273e	HITS-CLIP	23313552
MIRT457986	hsa-miR-665	HITS-CLIP	23313552
MIRT673437	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT673436	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT673435	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT673434	hsa-miR-4269	HITS-CLIP	23824327
MIRT673433	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT673432	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT673431	hsa-miR-4673	HITS-CLIP	23824327
MIRT673430	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT673429	hsa-miR-3179	HITS-CLIP	23824327
MIRT673428	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT673427	hsa-miR-564	HITS-CLIP	23824327
MIRT673426	hsa-miR-4284	HITS-CLIP	23824327
MIRT673425	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT673424	hsa-miR-2861	HITS-CLIP	23824327
MIRT673423	hsa-miR-4435	HITS-CLIP	23824327
MIRT457990	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT457991	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT457989	hsa-miR-940	PAR-CLIP	23592263
MIRT457988	hsa-miR-4459	PAR-CLIP	23592263
MIRT457987	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT457986	hsa-miR-665	PAR-CLIP	23592263
MIRT457985	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT457984	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT457983	hsa-miR-7162-3p	PAR-CLIP	23592263
MIRT457982	hsa-miR-1827	PAR-CLIP	23592263
MIRT457981	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT457980	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT457978	hsa-miR-4294	PAR-CLIP	23592263
MIRT457979	hsa-miR-1273e	PAR-CLIP	23592263
MIRT054353	hsa-miR-221-3p	Western blot, Immunohistochemistry, Luciferase reporter assay	25586265
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27021436
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27021436
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27021436
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27021436
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27021436
MIRT002410	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	27021436
MIRT736040	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	31452277
MIRT705610	hsa-miR-302f	HITS-CLIP	23313552
MIRT457990	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT457991	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT457989	hsa-miR-940	HITS-CLIP	23313552
MIRT705609	hsa-miR-3929	HITS-CLIP	23313552
MIRT705608	hsa-miR-4419b	HITS-CLIP	23313552
MIRT705607	hsa-miR-4478	HITS-CLIP	23313552
MIRT705606	hsa-miR-5588-3p	HITS-CLIP	23313552
MIRT705605	hsa-miR-2114-5p	HITS-CLIP	23313552
MIRT705604	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT705603	hsa-miR-5690	HITS-CLIP	23313552
MIRT705602	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT705601	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT457984	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT705600	hsa-miR-20b-3p	HITS-CLIP	23313552
MIRT705599	hsa-miR-219b-3p	HITS-CLIP	23313552
MIRT457982	hsa-miR-1827	HITS-CLIP	23313552
MIRT457981	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT705598	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT705597	hsa-miR-933	HITS-CLIP	23313552
MIRT705596	hsa-miR-7977	HITS-CLIP	23313552
MIRT705595	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT457979	hsa-miR-1273e	HITS-CLIP	23313552
MIRT457986	hsa-miR-665	HITS-CLIP	23313552
MIRT673437	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT673436	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT673435	hsa-miR-3622a-5p	HITS-CLIP	23824327
MIRT673434	hsa-miR-4269	HITS-CLIP	23824327
MIRT673433	hsa-miR-6715b-5p	HITS-CLIP	23824327
MIRT673432	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT673431	hsa-miR-4673	HITS-CLIP	23824327
MIRT673430	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT673429	hsa-miR-3179	HITS-CLIP	23824327
MIRT673428	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT673427	hsa-miR-564	HITS-CLIP	23824327
MIRT673426	hsa-miR-4284	HITS-CLIP	23824327
MIRT673425	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT673424	hsa-miR-2861	HITS-CLIP	23824327
MIRT673423	hsa-miR-4435	HITS-CLIP	23824327
MIRT457990	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT457991	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT457989	hsa-miR-940	PAR-CLIP	23592263
MIRT457988	hsa-miR-4459	PAR-CLIP	23592263
MIRT457987	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT457986	hsa-miR-665	PAR-CLIP	23592263
MIRT457985	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT457984	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT457983	hsa-miR-7162-3p	PAR-CLIP	23592263
MIRT457982	hsa-miR-1827	PAR-CLIP	23592263
MIRT457981	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT457980	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT457978	hsa-miR-4294	PAR-CLIP	23592263
MIRT457979	hsa-miR-1273e	PAR-CLIP	23592263
MIRT788589	hsa-miR-2054	CLIP-seq
MIRT788590	hsa-miR-216a	CLIP-seq
MIRT788591	hsa-miR-216b	CLIP-seq
MIRT788592	hsa-miR-24	CLIP-seq
MIRT788593	hsa-miR-3065-3p	CLIP-seq
MIRT788594	hsa-miR-3122	CLIP-seq
MIRT788595	hsa-miR-3689a-3p	CLIP-seq
MIRT788596	hsa-miR-3689c	CLIP-seq
MIRT788597	hsa-miR-3913-5p	CLIP-seq
MIRT788598	hsa-miR-4728-5p	CLIP-seq
MIRT788599	hsa-miR-1228	CLIP-seq
MIRT788600	hsa-miR-1255a	CLIP-seq
MIRT788601	hsa-miR-1255b	CLIP-seq
MIRT788602	hsa-miR-1262	CLIP-seq
MIRT788603	hsa-miR-1273g	CLIP-seq
MIRT788604	hsa-miR-1304	CLIP-seq
MIRT788605	hsa-miR-130a	CLIP-seq
MIRT788606	hsa-miR-130b	CLIP-seq
MIRT788607	hsa-miR-132	CLIP-seq
MIRT788608	hsa-miR-200b	CLIP-seq
MIRT788609	hsa-miR-200c	CLIP-seq
MIRT788589	hsa-miR-2054	CLIP-seq
MIRT788610	hsa-miR-2114	CLIP-seq
MIRT788611	hsa-miR-212	CLIP-seq
MIRT788590	hsa-miR-216a	CLIP-seq
MIRT788591	hsa-miR-216b	CLIP-seq
MIRT788612	hsa-miR-217	CLIP-seq
MIRT788613	hsa-miR-2964a-3p	CLIP-seq
MIRT788614	hsa-miR-301a	CLIP-seq
MIRT788615	hsa-miR-301b	CLIP-seq
MIRT788593	hsa-miR-3065-3p	CLIP-seq
MIRT788616	hsa-miR-3065-5p	CLIP-seq
MIRT788617	hsa-miR-3119	CLIP-seq
MIRT788594	hsa-miR-3122	CLIP-seq
MIRT788618	hsa-miR-3128	CLIP-seq
MIRT788619	hsa-miR-3153	CLIP-seq
MIRT788620	hsa-miR-3159	CLIP-seq
MIRT788621	hsa-miR-3170	CLIP-seq
MIRT788622	hsa-miR-3189-3p	CLIP-seq
MIRT788623	hsa-miR-330-3p	CLIP-seq
MIRT788624	hsa-miR-3605-5p	CLIP-seq
MIRT788625	hsa-miR-3612	CLIP-seq
MIRT788626	hsa-miR-3613-3p	CLIP-seq
MIRT788627	hsa-miR-3666	CLIP-seq
MIRT788595	hsa-miR-3689a-3p	CLIP-seq
MIRT788596	hsa-miR-3689c	CLIP-seq
MIRT788597	hsa-miR-3913-5p	CLIP-seq
MIRT788628	hsa-miR-3919	CLIP-seq
MIRT788629	hsa-miR-3942-3p	CLIP-seq
MIRT788630	hsa-miR-4252	CLIP-seq
MIRT788631	hsa-miR-4266	CLIP-seq
MIRT788632	hsa-miR-429	CLIP-seq
MIRT788633	hsa-miR-4295	CLIP-seq
MIRT788634	hsa-miR-4418	CLIP-seq
MIRT788635	hsa-miR-4474-5p	CLIP-seq
MIRT788636	hsa-miR-454	CLIP-seq
MIRT788637	hsa-miR-4640-3p	CLIP-seq
MIRT788638	hsa-miR-4671-3p	CLIP-seq
MIRT788639	hsa-miR-4695-5p	CLIP-seq
MIRT788640	hsa-miR-4697-3p	CLIP-seq
MIRT788641	hsa-miR-4701-3p	CLIP-seq
MIRT788642	hsa-miR-4712-3p	CLIP-seq
MIRT788598	hsa-miR-4728-5p	CLIP-seq
MIRT788643	hsa-miR-4756-3p	CLIP-seq
MIRT788644	hsa-miR-4760-5p	CLIP-seq
MIRT788645	hsa-miR-4793-3p	CLIP-seq
MIRT788646	hsa-miR-485-5p	CLIP-seq
MIRT788647	hsa-miR-508-5p	CLIP-seq
MIRT788648	hsa-miR-509-3-5p	CLIP-seq
MIRT788649	hsa-miR-509-5p	CLIP-seq
MIRT788650	hsa-miR-518a-5p	CLIP-seq
MIRT788651	hsa-miR-527	CLIP-seq
MIRT788652	hsa-miR-548ac	CLIP-seq
MIRT788653	hsa-miR-548ae	CLIP-seq
MIRT788654	hsa-miR-548aj	CLIP-seq
MIRT788655	hsa-miR-548am	CLIP-seq
MIRT788656	hsa-miR-548d-3p	CLIP-seq
MIRT788657	hsa-miR-548x	CLIP-seq
MIRT788658	hsa-miR-548z	CLIP-seq
MIRT788659	hsa-miR-555	CLIP-seq
MIRT788660	hsa-miR-595	CLIP-seq
MIRT788661	hsa-miR-650	CLIP-seq
MIRT788662	hsa-miR-651	CLIP-seq
MIRT788663	hsa-miR-661	CLIP-seq
MIRT788664	hsa-miR-766	CLIP-seq
MIRT788665	hsa-miR-885-3p	CLIP-seq
MIRT788666	hsa-miR-890	CLIP-seq
MIRT788667	hsa-miR-1276	CLIP-seq
MIRT788668	hsa-miR-128	CLIP-seq
MIRT788605	hsa-miR-130a	CLIP-seq
MIRT788606	hsa-miR-130b	CLIP-seq
MIRT788607	hsa-miR-132	CLIP-seq
MIRT788669	hsa-miR-145	CLIP-seq
MIRT788670	hsa-miR-19a	CLIP-seq
MIRT788671	hsa-miR-19b	CLIP-seq
MIRT788611	hsa-miR-212	CLIP-seq
MIRT788672	hsa-miR-2467-5p	CLIP-seq
MIRT788673	hsa-miR-27a	CLIP-seq
MIRT788674	hsa-miR-27b	CLIP-seq
MIRT788614	hsa-miR-301a	CLIP-seq
MIRT788615	hsa-miR-301b	CLIP-seq
MIRT788675	hsa-miR-30a	CLIP-seq
MIRT788676	hsa-miR-30b	CLIP-seq
MIRT788677	hsa-miR-30c	CLIP-seq
MIRT788678	hsa-miR-30d	CLIP-seq
MIRT788679	hsa-miR-30e	CLIP-seq
MIRT788680	hsa-miR-3188	CLIP-seq
MIRT788681	hsa-miR-3607-3p	CLIP-seq
MIRT788626	hsa-miR-3613-3p	CLIP-seq
MIRT788627	hsa-miR-3666	CLIP-seq
MIRT788682	hsa-miR-3975	CLIP-seq
MIRT788633	hsa-miR-4295	CLIP-seq
MIRT788683	hsa-miR-4311	CLIP-seq
MIRT788684	hsa-miR-4422	CLIP-seq
MIRT788685	hsa-miR-4433	CLIP-seq
MIRT788636	hsa-miR-454	CLIP-seq
MIRT788686	hsa-miR-4661-5p	CLIP-seq
MIRT788687	hsa-miR-4684-5p	CLIP-seq
MIRT788646	hsa-miR-485-5p	CLIP-seq
MIRT788652	hsa-miR-548ac	CLIP-seq
MIRT788688	hsa-miR-548c-3p	CLIP-seq
MIRT788656	hsa-miR-548d-3p	CLIP-seq
MIRT788658	hsa-miR-548z	CLIP-seq
MIRT788689	hsa-miR-583	CLIP-seq
MIRT788690	hsa-miR-596	CLIP-seq
MIRT788691	hsa-miR-935	CLIP-seq
MIRT788595	hsa-miR-3689a-3p	CLIP-seq
MIRT788596	hsa-miR-3689c	CLIP-seq
MIRT788598	hsa-miR-4728-5p	CLIP-seq
MIRT788646	hsa-miR-485-5p	CLIP-seq
MIRT1932574	hsa-miR-10a	CLIP-seq
MIRT1932575	hsa-miR-10b	CLIP-seq
MIRT1932576	hsa-miR-1182	CLIP-seq
MIRT1932577	hsa-miR-1225-5p	CLIP-seq
MIRT1932578	hsa-miR-136	CLIP-seq
MIRT1932579	hsa-miR-193a-5p	CLIP-seq
MIRT788610	hsa-miR-2114	CLIP-seq
MIRT788590	hsa-miR-216a	CLIP-seq
MIRT788591	hsa-miR-216b	CLIP-seq
MIRT1932580	hsa-miR-2276	CLIP-seq
MIRT1932581	hsa-miR-23a	CLIP-seq
MIRT1932582	hsa-miR-23b	CLIP-seq
MIRT1932583	hsa-miR-23c	CLIP-seq
MIRT788613	hsa-miR-2964a-3p	CLIP-seq
MIRT788593	hsa-miR-3065-3p	CLIP-seq
MIRT788616	hsa-miR-3065-5p	CLIP-seq
MIRT788594	hsa-miR-3122	CLIP-seq
MIRT788618	hsa-miR-3128	CLIP-seq
MIRT1932584	hsa-miR-3132	CLIP-seq
MIRT1932585	hsa-miR-324-5p	CLIP-seq
MIRT788623	hsa-miR-330-3p	CLIP-seq
MIRT1932586	hsa-miR-339-5p	CLIP-seq
MIRT788625	hsa-miR-3612	CLIP-seq
MIRT1932587	hsa-miR-3652	CLIP-seq
MIRT1932588	hsa-miR-3667-5p	CLIP-seq
MIRT788595	hsa-miR-3689a-3p	CLIP-seq
MIRT788596	hsa-miR-3689c	CLIP-seq
MIRT1932589	hsa-miR-371-5p	CLIP-seq
MIRT1932590	hsa-miR-378	CLIP-seq
MIRT1932591	hsa-miR-378b	CLIP-seq
MIRT1932592	hsa-miR-378c	CLIP-seq
MIRT1932593	hsa-miR-378d	CLIP-seq
MIRT1932594	hsa-miR-378e	CLIP-seq
MIRT1932595	hsa-miR-378f	CLIP-seq
MIRT1932596	hsa-miR-378h	CLIP-seq
MIRT1932597	hsa-miR-378i	CLIP-seq
MIRT788597	hsa-miR-3913-5p	CLIP-seq
MIRT1932598	hsa-miR-3924	CLIP-seq
MIRT1932599	hsa-miR-422a	CLIP-seq
MIRT788630	hsa-miR-4252	CLIP-seq
MIRT1932600	hsa-miR-4263	CLIP-seq
MIRT1932601	hsa-miR-4282	CLIP-seq
MIRT1932602	hsa-miR-431	CLIP-seq
MIRT788683	hsa-miR-4311	CLIP-seq
MIRT1932603	hsa-miR-4421	CLIP-seq
MIRT1932604	hsa-miR-4430	CLIP-seq
MIRT1932605	hsa-miR-4455	CLIP-seq
MIRT788635	hsa-miR-4474-5p	CLIP-seq
MIRT1932606	hsa-miR-4521	CLIP-seq
MIRT1932607	hsa-miR-4686	CLIP-seq
MIRT788639	hsa-miR-4695-5p	CLIP-seq
MIRT1932608	hsa-miR-4720-3p	CLIP-seq
MIRT1932609	hsa-miR-4725-5p	CLIP-seq
MIRT788598	hsa-miR-4728-5p	CLIP-seq
MIRT1932610	hsa-miR-4733-5p	CLIP-seq
MIRT1932611	hsa-miR-4772-3p	CLIP-seq
MIRT788645	hsa-miR-4793-3p	CLIP-seq
MIRT1932612	hsa-miR-4804-3p	CLIP-seq
MIRT788646	hsa-miR-485-5p	CLIP-seq
MIRT1932613	hsa-miR-504	CLIP-seq
MIRT788647	hsa-miR-508-5p	CLIP-seq
MIRT1932614	hsa-miR-5096	CLIP-seq
MIRT1932615	hsa-miR-548g	CLIP-seq
MIRT1932616	hsa-miR-550a	CLIP-seq
MIRT1932617	hsa-miR-579	CLIP-seq
MIRT1932618	hsa-miR-630	CLIP-seq
MIRT788661	hsa-miR-650	CLIP-seq
MIRT788664	hsa-miR-766	CLIP-seq
MIRT788665	hsa-miR-885-3p	CLIP-seq
MIRT1932619	hsa-miR-885-5p	CLIP-seq
MIRT1932620	hsa-miR-888	CLIP-seq
MIRT788666	hsa-miR-890	CLIP-seq
MIRT2172881	hsa-miR-300	CLIP-seq
MIRT2172882	hsa-miR-381	CLIP-seq
MIRT2172883	hsa-miR-4659a-3p	CLIP-seq
MIRT2172884	hsa-miR-4659b-3p	CLIP-seq
MIRT788666	hsa-miR-890	CLIP-seq
MIRT788605	hsa-miR-130a	CLIP-seq
MIRT788606	hsa-miR-130b	CLIP-seq
MIRT788614	hsa-miR-301a	CLIP-seq
MIRT788615	hsa-miR-301b	CLIP-seq
MIRT788627	hsa-miR-3666	CLIP-seq
MIRT788633	hsa-miR-4295	CLIP-seq
MIRT788636	hsa-miR-454	CLIP-seq
MIRT788638	hsa-miR-4671-3p	CLIP-seq
MIRT2435424	hsa-miR-1202	CLIP-seq
MIRT2435425	hsa-miR-139-5p	CLIP-seq
MIRT2435426	hsa-miR-183	CLIP-seq
MIRT2435427	hsa-miR-198	CLIP-seq
MIRT2435428	hsa-miR-3194-5p	CLIP-seq
MIRT2435429	hsa-miR-3972	CLIP-seq
MIRT2435430	hsa-miR-4446-3p	CLIP-seq
MIRT2435431	hsa-miR-4530	CLIP-seq
MIRT2435432	hsa-miR-539	CLIP-seq
MIRT2435433	hsa-miR-548v	CLIP-seq
MIRT2435434	hsa-miR-549	CLIP-seq
MIRT2435435	hsa-miR-646	CLIP-seq
MIRT1932574	hsa-miR-10a	CLIP-seq
MIRT1932575	hsa-miR-10b	CLIP-seq
MIRT2435424	hsa-miR-1202	CLIP-seq
MIRT788667	hsa-miR-1276	CLIP-seq
MIRT2443766	hsa-miR-1283	CLIP-seq
MIRT2443767	hsa-miR-1301	CLIP-seq
MIRT788605	hsa-miR-130a	CLIP-seq
MIRT788606	hsa-miR-130b	CLIP-seq
MIRT2435425	hsa-miR-139-5p	CLIP-seq
MIRT2435426	hsa-miR-183	CLIP-seq
MIRT2435427	hsa-miR-198	CLIP-seq
MIRT788670	hsa-miR-19a	CLIP-seq
MIRT788671	hsa-miR-19b	CLIP-seq
MIRT788590	hsa-miR-216a	CLIP-seq
MIRT788591	hsa-miR-216b	CLIP-seq
MIRT788614	hsa-miR-301a	CLIP-seq
MIRT788615	hsa-miR-301b	CLIP-seq
MIRT788593	hsa-miR-3065-3p	CLIP-seq
MIRT788594	hsa-miR-3122	CLIP-seq
MIRT1932584	hsa-miR-3132	CLIP-seq
MIRT2435428	hsa-miR-3194-5p	CLIP-seq
MIRT2443768	hsa-miR-331-5p	CLIP-seq
MIRT2443769	hsa-miR-338-5p	CLIP-seq
MIRT1932586	hsa-miR-339-5p	CLIP-seq
MIRT788626	hsa-miR-3613-3p	CLIP-seq
MIRT788627	hsa-miR-3666	CLIP-seq
MIRT2443770	hsa-miR-3680	CLIP-seq
MIRT788595	hsa-miR-3689a-3p	CLIP-seq
MIRT788596	hsa-miR-3689c	CLIP-seq
MIRT788597	hsa-miR-3913-5p	CLIP-seq
MIRT2435429	hsa-miR-3972	CLIP-seq
MIRT788633	hsa-miR-4295	CLIP-seq
MIRT788683	hsa-miR-4311	CLIP-seq
MIRT1932603	hsa-miR-4421	CLIP-seq
MIRT788684	hsa-miR-4422	CLIP-seq
MIRT2443771	hsa-miR-4432	CLIP-seq
MIRT2435430	hsa-miR-4446-3p	CLIP-seq
MIRT2435431	hsa-miR-4530	CLIP-seq
MIRT788636	hsa-miR-454	CLIP-seq
MIRT2443772	hsa-miR-4659a-5p	CLIP-seq
MIRT2443773	hsa-miR-4659b-5p	CLIP-seq
MIRT2443774	hsa-miR-4660	CLIP-seq
MIRT2443775	hsa-miR-4678	CLIP-seq
MIRT788687	hsa-miR-4684-5p	CLIP-seq
MIRT1932609	hsa-miR-4725-5p	CLIP-seq
MIRT788598	hsa-miR-4728-5p	CLIP-seq
MIRT2443776	hsa-miR-4786-5p	CLIP-seq
MIRT2443777	hsa-miR-487a	CLIP-seq
MIRT1932613	hsa-miR-504	CLIP-seq
MIRT2443778	hsa-miR-5047	CLIP-seq
MIRT788652	hsa-miR-548ac	CLIP-seq
MIRT788688	hsa-miR-548c-3p	CLIP-seq
MIRT788656	hsa-miR-548d-3p	CLIP-seq
MIRT2435433	hsa-miR-548v	CLIP-seq
MIRT788658	hsa-miR-548z	CLIP-seq
MIRT2435434	hsa-miR-549	CLIP-seq
MIRT788689	hsa-miR-583	CLIP-seq
MIRT2443779	hsa-miR-593	CLIP-seq
MIRT2443780	hsa-miR-605	CLIP-seq
MIRT2435435	hsa-miR-646	CLIP-seq
MIRT2443781	hsa-miR-769-5p	CLIP-seq
MIRT1932574	hsa-miR-10a	CLIP-seq
MIRT1932575	hsa-miR-10b	CLIP-seq
MIRT2435424	hsa-miR-1202	CLIP-seq
MIRT788602	hsa-miR-1262	CLIP-seq
MIRT2443766	hsa-miR-1283	CLIP-seq
MIRT788605	hsa-miR-130a	CLIP-seq
MIRT788606	hsa-miR-130b	CLIP-seq
MIRT2435425	hsa-miR-139-5p	CLIP-seq
MIRT2476037	hsa-miR-149	CLIP-seq
MIRT2435426	hsa-miR-183	CLIP-seq
MIRT2435427	hsa-miR-198	CLIP-seq
MIRT2476038	hsa-miR-208a	CLIP-seq
MIRT2476039	hsa-miR-208b	CLIP-seq
MIRT788590	hsa-miR-216a	CLIP-seq
MIRT788591	hsa-miR-216b	CLIP-seq
MIRT1932580	hsa-miR-2276	CLIP-seq
MIRT2172881	hsa-miR-300	CLIP-seq
MIRT788614	hsa-miR-301a	CLIP-seq
MIRT788615	hsa-miR-301b	CLIP-seq
MIRT788593	hsa-miR-3065-3p	CLIP-seq
MIRT788594	hsa-miR-3122	CLIP-seq
MIRT2476040	hsa-miR-3124-3p	CLIP-seq
MIRT1932584	hsa-miR-3132	CLIP-seq
MIRT2476041	hsa-miR-3133	CLIP-seq
MIRT2476042	hsa-miR-3163	CLIP-seq
MIRT2435428	hsa-miR-3194-5p	CLIP-seq
MIRT1932586	hsa-miR-339-5p	CLIP-seq
MIRT2476043	hsa-miR-3529	CLIP-seq
MIRT2476044	hsa-miR-3617	CLIP-seq
MIRT2476045	hsa-miR-3658	CLIP-seq
MIRT788627	hsa-miR-3666	CLIP-seq
MIRT2476046	hsa-miR-3682-5p	CLIP-seq
MIRT788595	hsa-miR-3689a-3p	CLIP-seq
MIRT788596	hsa-miR-3689c	CLIP-seq
MIRT2476047	hsa-miR-379	CLIP-seq
MIRT2172882	hsa-miR-381	CLIP-seq
MIRT788597	hsa-miR-3913-5p	CLIP-seq
MIRT2435429	hsa-miR-3972	CLIP-seq
MIRT788630	hsa-miR-4252	CLIP-seq
MIRT788633	hsa-miR-4295	CLIP-seq
MIRT1932603	hsa-miR-4421	CLIP-seq
MIRT2476048	hsa-miR-4437	CLIP-seq
MIRT2435430	hsa-miR-4446-3p	CLIP-seq
MIRT2476049	hsa-miR-4511	CLIP-seq
MIRT2435431	hsa-miR-4530	CLIP-seq
MIRT788636	hsa-miR-454	CLIP-seq
MIRT2172883	hsa-miR-4659a-3p	CLIP-seq
MIRT2172884	hsa-miR-4659b-3p	CLIP-seq
MIRT2476050	hsa-miR-4668-3p	CLIP-seq
MIRT788638	hsa-miR-4671-3p	CLIP-seq
MIRT788687	hsa-miR-4684-5p	CLIP-seq
MIRT2476051	hsa-miR-4685-5p	CLIP-seq
MIRT1932607	hsa-miR-4686	CLIP-seq
MIRT788641	hsa-miR-4701-3p	CLIP-seq
MIRT2476052	hsa-miR-4715-3p	CLIP-seq
MIRT2476053	hsa-miR-4719	CLIP-seq
MIRT1932609	hsa-miR-4725-5p	CLIP-seq
MIRT788598	hsa-miR-4728-5p	CLIP-seq
MIRT1932610	hsa-miR-4733-5p	CLIP-seq
MIRT2476054	hsa-miR-4735-5p	CLIP-seq
MIRT1932611	hsa-miR-4772-3p	CLIP-seq
MIRT2443776	hsa-miR-4786-5p	CLIP-seq
MIRT788645	hsa-miR-4793-3p	CLIP-seq
MIRT788646	hsa-miR-485-5p	CLIP-seq
MIRT2476055	hsa-miR-499-5p	CLIP-seq
MIRT1932613	hsa-miR-504	CLIP-seq
MIRT788647	hsa-miR-508-5p	CLIP-seq
MIRT2476056	hsa-miR-513b	CLIP-seq
MIRT2435432	hsa-miR-539	CLIP-seq
MIRT788688	hsa-miR-548c-3p	CLIP-seq
MIRT2435433	hsa-miR-548v	CLIP-seq
MIRT2435434	hsa-miR-549	CLIP-seq
MIRT2443779	hsa-miR-593	CLIP-seq
MIRT2476057	hsa-miR-641	CLIP-seq
MIRT2435435	hsa-miR-646	CLIP-seq
MIRT788663	hsa-miR-661	CLIP-seq
MIRT788664	hsa-miR-766	CLIP-seq
MIRT2443781	hsa-miR-769-5p	CLIP-seq
MIRT2172883	hsa-miR-4659a-3p	CLIP-seq
MIRT2172884	hsa-miR-4659b-3p	CLIP-seq
MIRT2172883	hsa-miR-4659a-3p	CLIP-seq
MIRT2172884	hsa-miR-4659b-3p	CLIP-seq

Transcription factors Show/Hide all (6)

Transcription factor	Regulation	Reference
E2F1	Activation	12149244;12766778;17600109
E2F1	Unknown	15972851
E2F6	Repression	17600109
HDAC2	Repression	18834886
SP1	Unknown	15972851
TP53	Unknown	11896574;15972851

Gene ontology (GO) Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000166	Function	Nucleotide binding	TAS	10383829
GO:0001666	Process	Response to hypoxia	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0005515	Function	Protein binding	IPI	9267021, 9922454, 10206961, 10376594, 10949025, 11112785, 11821383, 15735003, 17274640, 19494828, 20462491, 21371431, 21827945, 22246185
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	9267021
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9753320
GO:0007399	Process	Nervous system development	TAS	9753320
GO:0007420	Process	Brain development	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	IEA
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0032991	Component	Protein-containing complex	IDA	11821383
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	10441496
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9267021, 21827945
GO:0043065	Process	Positive regulation of apoptotic process	TAS	18309324
GO:0043293	Component	Apoptosome	IDA	21827945
GO:0043293	Component	Apoptosome	IEA
GO:0043293	Component	Apoptosome	IPI	10206961
GO:0043293	Component	Apoptosome	TAS	18309324
GO:0043531	Function	ADP binding	IEA
GO:0048731	Process	System development	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0072432	Process	Response to G1 DNA damage checkpoint signaling	TAS	18309324
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	NAS	10206961
GO:0097193	Process	Intrinsic apoptotic signaling pathway	TAS	18309324
GO:0140608	Function	Cysteine-type endopeptidase activator activity	NAS	15009102
GO:0140608	Function	Cysteine-type endopeptidase activator activity	TAS	9267021
GO:1902510	Process	Regulation of apoptotic DNA fragmentation	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 602233
• HGNC: 576
• e!Ensembl: ENSG00000120868

Protein

• UniProt ID: O14727
• Protein name: Apoptotic protease-activating factor 1 (APAF-1)
• Protein function: Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP. Isoform 6 is less effective in inducing apoptosis. {ECO
• PDB: 1C15 , 1CWW , 1CY5 , 1Z6T , 2P1H , 2YGS , 3J2T , 3JBT , 3YGS , 4RHW , 5JUY , 5WVC , 5WVE , 8XQK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	733 → 771	WD domain, G-beta repeat	Repeat
  PF00400	WD40	1118 → 1155	WD domain, G-beta repeat	Repeat
  PF00400	WD40	647 → 685	WD domain, G-beta repeat	Repeat
  PF00400	WD40	872 → 910	WD domain, G-beta repeat	Repeat
  PF00400	WD40	689 → 729	WD domain, G-beta repeat	Repeat
  PF00400	WD40	1167 → 1203	WD domain, G-beta repeat	Repeat
  PF00400	WD40	605 → 643	WD domain, G-beta repeat	Repeat
  PF00400	WD40	1075 → 1113	WD domain, G-beta repeat	Repeat
  PF00400	WD40	992 → 1031	WD domain, G-beta repeat	Repeat
  PF00619	CARD	6 → 90	Caspase recruitment domain	Domain
  PF00931	NB-ARC	129 → 374	NB-ARC domain	Domain
  PF17908	APAF1_C	453 → 587	APAF-1 helical domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
• Sequence:

  MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
  LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
  QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
  GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
  ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
  MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
  YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
  KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
  MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
  SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
  KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
  LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
  SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
  INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
  STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
  SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT
  EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
  SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD
  FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
  LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
  WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE

• Sequence length: 1248

Pathways

KEGG Pathway	Reactome Pathway
Platinum drug resistance	Formation of apoptosome
p53 signaling pathway	Activation of caspases through apoptosome-mediated cleavage
Apoptosis	Neutrophil degranulation
Apoptosis - multiple species	TP53 Regulates Transcription of Caspase Activators and Caspases
Alzheimer disease	Transcriptional Regulation by E2F6
Parkinson disease	Regulation of the apoptosome activity
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Legionellosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Pathways in cancer
Small cell lung cancer
Lipid and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (17)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
APAF1-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	17133271	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	17133271	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF SKIN	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	9753320, 9753321	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet, GenCC Disgenet, GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	9753320	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural tube defect	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	CTD, Disgenet CTD, Disgenet	18497877	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN ABNORMALITIES	—	CTD	9753320	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (149)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	15972851, 18587015		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15899912, 18587015, 23093495		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18587015		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17882496		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16231180		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15899912		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24424093		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	16046141		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24920239	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27221781, 27863378, 28693160, 29620207, 30251772		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	16897188		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16642478, 17160380, 18587251, 31131537		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	17361096		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	LHGDN	17361096		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	18093951		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18093951	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31410016		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20829044	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15692060		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15692060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20977544	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16231180		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	20977544	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27342975, 31094091	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17160380, 31131537		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25586265, 31328388		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16861932, 22996741		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17133271, 21922274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	17133271, 17160380, 17541304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28350128		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35432334	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15899912		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16331630, 16897188, 19074885, 30556269		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26743285	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21528061, 36866552	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	26743285	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15378005, 17350821, 17516584, 24992592, 25599959, 28423356		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17603079		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22481083, 24992592, 28423356	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16951219, 17133271, 21922274, 26198328		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12019468, 12477763		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12477763	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	15009102, 15026369		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	27141571	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27863378		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	10862031		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14655749, 23822711, 29236891		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	14655749, 23822711	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14655749, 23822711, 29236891		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11870542	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23865473		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23093495		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15590702, 31329620		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	31329620	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19061491	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	24142530	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	17133271		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	29503530	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28453462		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11435311, 12545166, 12642862		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11435311, 11895790	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15972851		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15972851	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15899912, 18587015		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18719738		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17380155, 27342975, 31094091		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28895780, 34308964	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28453462	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10441496, 15692060, 27863378		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15692060		★☆☆☆☆ Found in Text Mining only
Lysinuric Protein Intolerance	Lysinuric Protein Intolerance	BEFREE	22403019		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16231040, 19455599		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	16231040, 19455599		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	31410016		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17133271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	25586265, 31328388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16861932, 22996741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11429402, 28350128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25701323		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12804598, 16920735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17876870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17160380, 31131537		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11706994, 14655749, 15972851, 25701323, 28399853, 28982084, 31094091		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11196646, 11511973, 11896617, 15009102, 15026369, 15305193, 15492260, 16095810, 17143490, 31329620		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15009102, 15026369, 15305193, 15649154, 15832174, 15832175, 16232302, 16420245		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15305193	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19383853, 20216471, 20977544, 31329620, 36351409	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	15305193	Inhibit	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15009102, 15205316, 15305193		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	20345447		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	12644018	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24920239, 31541852	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17557868, 24816239, 27032384, 30551468		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17557868, 24816239, 31918281	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	20345447		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20345447		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24142530	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17361096, 17603723, 27009330		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	17361096		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29279737		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24845412, 31634779	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10441496, 11196646, 11410874, 11896617, 12655145, 14655749, 15009102, 15026369, 15101558, 15305193, 15492260, 15972851, 16095810, 16231180, 16597645, 16642478, 16951219, 17133271, 17160380, 17541304, 17557868, 17945286, 18834886, 19061491, 19522860, 20345447, 21922274, 22308476, 23408418, 23613234, 25064172, 30066861, 31321477, 31661694		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	29358613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	29358613	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	11896617, 21104989, 28426994, 30066861		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12413423		★☆☆☆☆ Found in Text Mining only
Nevi and Melanomas	Congenital melanocytic nevus syndrome	BEFREE	15009102		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12591734, 15101558, 16231180, 28982084, 31329620		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24797937		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28350128		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11429402, 20925046	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25701323		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11535810, 12413423, 12946058		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37108258	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29154960		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23093495		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27644318		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12804598, 16920735		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33509203	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38162988	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17133271		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16951219, 17945286, 21922274		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16951219		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	CTD_human_DG	18497877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Pigment Epithelial Detachment	Retinal Pigment Epithelial Detachment	CTD_human_DG	18497877		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28118944		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	17133271		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	20977544	Stimulate	★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	31321477		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	11504943		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17026852, 28453462	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30344679		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27038158		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17876870		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17876870		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17876870, 23326121, 32993565	Associate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	17133271, 17160380, 17541304		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	20977544	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16547620		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	17541304		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16231040, 19455599		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	16231040, 19455599		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17160380, 17541304, 23613234	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ZIC5 2 shared diseasesCraniofacial abnormalities, Neural tube defect 3 shared evidence sourcesCTD (Craniofacial abnormalities), Disgenet (Craniofacial abnormalities), Disgenet (Neural tube defect) Related via 2 shared diseases including Craniofacial abnormalities, Neural tube defect — evidence mostly Disgenet. M6PR 2 shared diseasesRenal cell carcinoma, Depression 2 shared evidence sourcesCTD (Renal cell carcinoma), Disgenet (Depression) Related via 2 shared diseases including Renal cell carcinoma, Depression — evidence mostly CTD. CASP9 1 shared diseaseRetinal detachment 19 shared pathwaysPlatinum drug resistance, p53 signaling pathway, Apoptosis, Apoptosis - multiple species, Parkinson disease, Prion disease, Legionellosis, Tuberculosis, Hepatitis C, Hepatitis B, Measles, Influenza A +7 more 2 shared evidence sourcesCTD (Retinal detachment), Disgenet (Retinal detachment) Related via 19 shared pathways including Platinum drug resistance, p53 signaling pathway — evidence mostly CTD. NDST1 2 shared diseasesCraniofacial abnormalities, Eye abnormalities 4 shared evidence sourcesCTD (Craniofacial abnormalities), Disgenet (Craniofacial abnormalities), CTD (Eye abnormalities), Disgenet (Eye abnormalities) Related via 2 shared diseases including Craniofacial abnormalities, Eye abnormalities — evidence mostly CTD. BMPR1A 2 shared diseasesCraniofacial abnormalities, Eye abnormalities 4 shared evidence sourcesCTD (Craniofacial abnormalities), Disgenet (Craniofacial abnormalities), CTD (Eye abnormalities), Disgenet (Eye abnormalities) Related via 2 shared diseases including Craniofacial abnormalities, Eye abnormalities — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ZIC5	2	["Craniofacial abnormalities","Neural tube defect"]	0	[]	3	["CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)","Disgenet (Neural tube defect)"]
M6PR	2	["Renal cell carcinoma","Depression"]	0	[]	2	["CTD (Renal cell carcinoma)","Disgenet (Depression)"]
CASP9	1	["Retinal detachment"]	19	["Platinum drug resistance","p53 signaling pathway","Apoptosis","Apoptosis - multiple species","Parkinson disease","Prion disease","Legionellosis","Tuberculosis","Hepatitis C","Hepatitis B","Measles","Influenza A"]	2	["CTD (Retinal detachment)","Disgenet (Retinal detachment)"]
NDST1	2	["Craniofacial abnormalities","Eye abnormalities"]	0	[]	4	["CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)","CTD (Eye abnormalities)","Disgenet (Eye abnormalities)"]
BMPR1A	2	["Craniofacial abnormalities","Eye abnormalities"]	0	[]	4	["CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)","CTD (Eye abnormalities)","Disgenet (Eye abnormalities)"]

Diseases Linked via Similar Genes

Prostatic neoplasms Linked via 2 of 5 related genesM6PR, CASP9 Diabetes mellitus type 2 Linked via 2 of 5 related genesM6PR, CASP9 Gout Linked via 2 of 5 related genesCASP9, BMPR1A Alzheimer disease Linked via 1 of 5 related genesZIC5 Hepatocellular carcinoma Linked via 1 of 5 related genesZIC5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Prostatic neoplasms	2	["M6PR","CASP9"]
Diabetes mellitus type 2	2	["M6PR","CASP9"]
Gout	2	["CASP9","BMPR1A"]
Alzheimer disease	1	["ZIC5"]
Hepatocellular carcinoma	1	["ZIC5"]