ANGPTL8 (angiopoietin like 8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55908
Gene name Angiopoietin like 8
Gene symbol ANGPTL8
Synonyms (NCBI Gene)
C19orf80PRO1185PVPA599RIFLTD26
Chromosome 19
Chromosome location 19p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23 Show/Hide all (23)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IEA
GO:0005515 Function Protein binding IPI 21988832
GO:0005576 Component Extracellular region IBA
GO:0005576 Component Extracellular region IDA 23150577
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616223 24933 ENSG00000130173
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UXH0
Protein name Angiopoietin-like protein 8 (Betatrophin) (Lipasin) (Refeeding-induced fat and liver protein)
Protein function Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels (PubMed:22569073, PubMed:22809513, PubMed:23150577). May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids t
Family and domains
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in liver. Also expressed in adipose tissues. {ECO:0000269|PubMed:22569073, ECO:0000269|PubMed:22809513}.
Sequence 
MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRL
TKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVA
QAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQ
QHRLRQIQERLHTAALPA
Sequence length 198
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Cholesterol metabolism Assembly of active LPL and LIPC lipase complexes
Sort by:
ANGPTL3 2 shared pathwaysCholesterol metabolism, Assembly of active LPL and LIPC lipase complexes Related via 2 shared pathways including Cholesterol metabolism, Assembly of active LPL and LIPC lipase complexes. LIPC 2 shared pathwaysCholesterol metabolism, Assembly of active LPL and LIPC lipase complexes Related via 2 shared pathways including Cholesterol metabolism, Assembly of active LPL and LIPC lipase complexes. ANGPTL4 2 shared pathwaysCholesterol metabolism, Assembly of active LPL and LIPC lipase complexes Related via 2 shared pathways including Cholesterol metabolism, Assembly of active LPL and LIPC lipase complexes. LPL 2 shared pathwaysCholesterol metabolism, Assembly of active LPL and LIPC lipase complexes Related via 2 shared pathways including Cholesterol metabolism, Assembly of active LPL and LIPC lipase complexes.
Ischemic heart disease Linked via 3 of 4 related genesLIPC, ANGPTL4, LPL Coronary artery disease Linked via 3 of 4 related genesLIPC, ANGPTL4, LPL Diabetes mellitus type 2 Linked via 3 of 4 related genesLIPC, ANGPTL4, LPL Hyperlipidemia Linked via 3 of 4 related genesLIPC, ANGPTL4, LPL Metabolic syndrome Linked via 3 of 4 related genesLIPC, ANGPTL4, LPL