Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	183
Gene name	Angiotensinogen
Gene symbol	AGT
Synonyms (NCBI Gene)	ANHUSERPINA8hFLT1
Chromosome	1
Chromosome location	1q42.2
Summary	The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin co

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs699	A>G	Benign, risk-factor	Coding sequence variant, missense variant
rs74315283	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs121912702	G>A	Pathogenic	Stop gained, coding sequence variant
rs387906578	A>-,AA	Pathogenic	Coding sequence variant, frameshift variant, stop gained
rs747815674	C>A	Pathogenic	Splice donor variant
rs778806374	G>A	Pathogenic	Coding sequence variant, stop gained

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028917	hsa-miR-26b-5p	Microarray	19088304
MIRT2168949	hsa-miR-3613-3p	CLIP-seq
MIRT2168950	hsa-miR-4457	CLIP-seq
MIRT2168951	hsa-miR-513b	CLIP-seq
MIRT2168952	hsa-miR-548c-3p	CLIP-seq
MIRT2464834	hsa-miR-337-5p	CLIP-seq
MIRT2464835	hsa-miR-3684	CLIP-seq
MIRT2464836	hsa-miR-4428	CLIP-seq
MIRT2471486	hsa-miR-1202	CLIP-seq
MIRT2471487	hsa-miR-1245b-5p	CLIP-seq
MIRT2471488	hsa-miR-125a-3p	CLIP-seq
MIRT2471489	hsa-miR-1291	CLIP-seq
MIRT2471490	hsa-miR-181a	CLIP-seq
MIRT2471491	hsa-miR-181b	CLIP-seq
MIRT2471492	hsa-miR-181c	CLIP-seq
MIRT2471493	hsa-miR-181d	CLIP-seq
MIRT2471494	hsa-miR-2116	CLIP-seq
MIRT2471495	hsa-miR-2117	CLIP-seq
MIRT2471496	hsa-miR-2355-3p	CLIP-seq
MIRT2471497	hsa-miR-2467-3p	CLIP-seq
MIRT2471498	hsa-miR-3117-5p	CLIP-seq
MIRT2471499	hsa-miR-3121-5p	CLIP-seq
MIRT2471500	hsa-miR-3142	CLIP-seq
MIRT2471501	hsa-miR-3152-5p	CLIP-seq
MIRT2471502	hsa-miR-3160-5p	CLIP-seq
MIRT2471503	hsa-miR-3176	CLIP-seq
MIRT2471504	hsa-miR-3180-5p	CLIP-seq
MIRT2464834	hsa-miR-337-5p	CLIP-seq
MIRT2168949	hsa-miR-3613-3p	CLIP-seq
MIRT2464835	hsa-miR-3684	CLIP-seq
MIRT2471505	hsa-miR-375	CLIP-seq
MIRT2471506	hsa-miR-3922-3p	CLIP-seq
MIRT2471507	hsa-miR-3934	CLIP-seq
MIRT2471508	hsa-miR-3972	CLIP-seq
MIRT2471509	hsa-miR-3973	CLIP-seq
MIRT2471510	hsa-miR-4262	CLIP-seq
MIRT2471511	hsa-miR-4267	CLIP-seq
MIRT2471512	hsa-miR-4269	CLIP-seq
MIRT2471513	hsa-miR-4273	CLIP-seq
MIRT2471514	hsa-miR-4314	CLIP-seq
MIRT2471515	hsa-miR-4327	CLIP-seq
MIRT2464836	hsa-miR-4428	CLIP-seq
MIRT2471516	hsa-miR-4431	CLIP-seq
MIRT2168950	hsa-miR-4457	CLIP-seq
MIRT2471517	hsa-miR-4463	CLIP-seq
MIRT2471518	hsa-miR-4645-5p	CLIP-seq
MIRT2471519	hsa-miR-4646-3p	CLIP-seq
MIRT2471520	hsa-miR-4667-5p	CLIP-seq
MIRT2471521	hsa-miR-4673	CLIP-seq
MIRT2471522	hsa-miR-4677-5p	CLIP-seq
MIRT2471523	hsa-miR-4686	CLIP-seq
MIRT2471524	hsa-miR-4688	CLIP-seq
MIRT2471525	hsa-miR-4700-5p	CLIP-seq
MIRT2471526	hsa-miR-4731-3p	CLIP-seq
MIRT2471527	hsa-miR-4753-5p	CLIP-seq
MIRT2471528	hsa-miR-4755-3p	CLIP-seq
MIRT2471529	hsa-miR-4774-3p	CLIP-seq
MIRT2471530	hsa-miR-4775	CLIP-seq
MIRT2471531	hsa-miR-4801	CLIP-seq
MIRT2471532	hsa-miR-486-3p	CLIP-seq
MIRT2471533	hsa-miR-513c	CLIP-seq
MIRT2471534	hsa-miR-514b-5p	CLIP-seq
MIRT2471535	hsa-miR-520g	CLIP-seq
MIRT2471536	hsa-miR-520h	CLIP-seq
MIRT2471537	hsa-miR-539	CLIP-seq
MIRT2471538	hsa-miR-548aa	CLIP-seq
MIRT2168952	hsa-miR-548c-3p	CLIP-seq
MIRT2471539	hsa-miR-584	CLIP-seq
MIRT2471540	hsa-miR-590-3p	CLIP-seq
MIRT2471541	hsa-miR-600	CLIP-seq
MIRT2471542	hsa-miR-602	CLIP-seq
MIRT2471543	hsa-miR-636	CLIP-seq
MIRT2471544	hsa-miR-637	CLIP-seq
MIRT2471545	hsa-miR-642b	CLIP-seq
MIRT2471546	hsa-miR-764	CLIP-seq
MIRT2471547	hsa-miR-892a	CLIP-seq
MIRT2471486	hsa-miR-1202	CLIP-seq
MIRT2471487	hsa-miR-1245b-5p	CLIP-seq
MIRT2471490	hsa-miR-181a	CLIP-seq
MIRT2471491	hsa-miR-181b	CLIP-seq
MIRT2471492	hsa-miR-181c	CLIP-seq
MIRT2471493	hsa-miR-181d	CLIP-seq
MIRT2471494	hsa-miR-2116	CLIP-seq
MIRT2471496	hsa-miR-2355-3p	CLIP-seq
MIRT2471497	hsa-miR-2467-3p	CLIP-seq
MIRT2471498	hsa-miR-3117-5p	CLIP-seq
MIRT2471499	hsa-miR-3121-5p	CLIP-seq
MIRT2471500	hsa-miR-3142	CLIP-seq
MIRT2471501	hsa-miR-3152-5p	CLIP-seq
MIRT2471502	hsa-miR-3160-5p	CLIP-seq
MIRT2471503	hsa-miR-3176	CLIP-seq
MIRT2471504	hsa-miR-3180-5p	CLIP-seq
MIRT2464834	hsa-miR-337-5p	CLIP-seq
MIRT2464835	hsa-miR-3684	CLIP-seq
MIRT2471506	hsa-miR-3922-3p	CLIP-seq
MIRT2471508	hsa-miR-3972	CLIP-seq
MIRT2471509	hsa-miR-3973	CLIP-seq
MIRT2471510	hsa-miR-4262	CLIP-seq
MIRT2471511	hsa-miR-4267	CLIP-seq
MIRT2464836	hsa-miR-4428	CLIP-seq
MIRT2471516	hsa-miR-4431	CLIP-seq
MIRT2471518	hsa-miR-4645-5p	CLIP-seq
MIRT2471519	hsa-miR-4646-3p	CLIP-seq
MIRT2471521	hsa-miR-4673	CLIP-seq
MIRT2471522	hsa-miR-4677-5p	CLIP-seq
MIRT2471523	hsa-miR-4686	CLIP-seq
MIRT2471524	hsa-miR-4688	CLIP-seq
MIRT2471527	hsa-miR-4753-5p	CLIP-seq
MIRT2471528	hsa-miR-4755-3p	CLIP-seq
MIRT2471529	hsa-miR-4774-3p	CLIP-seq
MIRT2471532	hsa-miR-486-3p	CLIP-seq
MIRT2471535	hsa-miR-520g	CLIP-seq
MIRT2471536	hsa-miR-520h	CLIP-seq
MIRT2471541	hsa-miR-600	CLIP-seq
MIRT2471542	hsa-miR-602	CLIP-seq
MIRT2471545	hsa-miR-642b	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
NFKB1	Unknown	10628750;8613256
RELA	Unknown	10628750;8613256
SP1	Unknown	12032593
USF1	Repression	18802024
YBX1	Activation	11829142

Show/Hide all (87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	17159080
GO:0001819	Process	Positive regulation of cytokine production	IDA	17906677
GO:0001822	Process	Kidney development	IMP	16116425
GO:0001974	Process	Blood vessel remodeling	TAS	10406457
GO:0002016	Process	Regulation of blood volume by renin-angiotensin	NAS	17159080
GO:0002018	Process	Renin-angiotensin regulation of aldosterone production	NAS	17159080
GO:0002019	Process	Regulation of renal output by angiotensin	NAS	17159080
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	IDA	26420482
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	IDA	1567413
GO:0002034	Process	Maintenance of blood vessel diameter homeostasis by renin-angiotensin	TAS	10406457
GO:0003014	Process	Renal system process	IDA	21183621
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	3397061
GO:0005179	Function	Hormone activity	IC	1378723
GO:0005179	Function	Hormone activity	IDA	1567413
GO:0005179	Function	Hormone activity	ISS
GO:0005515	Function	Protein binding	IPI	10969042, 11815627, 16237761, 18202720, 20927107, 23082758, 23597562, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	1378723
GO:0005615	Component	Extracellular space	IDA	4300938
GO:0005615	Component	Extracellular space	IDA	18971559
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	10406457
GO:0007199	Process	G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger	TAS	17159080
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	NAS	17159080
GO:0007267	Process	Cell-cell signaling	TAS	8513325
GO:0008083	Function	Growth factor activity	IDA	10406457
GO:0008217	Process	Regulation of blood pressure	IGI	17416596
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	15652490
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	24296617
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	18971559
GO:0014873	Process	Response to muscle activity involved in regulation of muscle adaptation	ISS
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	TAS	19193863
GO:0017080	Function	Sodium channel regulator activity	IMP	15803439, 17703433
GO:0019229	Process	Regulation of vasoconstriction	NAS	17159080
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0031702	Function	Type 1 angiotensin receptor binding	IPI	1378723
GO:0031703	Function	Type 2 angiotensin receptor binding	IPI	10406457
GO:0032930	Process	Positive regulation of superoxide anion generation	TAS	19193863
GO:0034374	Process	Low-density lipoprotein particle remodeling	NAS	17069818
GO:0035813	Process	Regulation of renal sodium excretion	NAS	17159080
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	TAS	17159080
GO:0038166	Process	Angiotensin-activated signaling pathway	IDA	1567413
GO:0038166	Process	Angiotensin-activated signaling pathway	IDA	1567413, 15652490, 18971559, 24296617
GO:0038166	Process	Angiotensin-activated signaling pathway	IMP	15153556
GO:0042127	Process	Regulation of cell population proliferation	NAS	17159080
GO:0042310	Process	Vasoconstriction	IEA
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	23453970, 35093948
GO:0043407	Process	Negative regulation of MAP kinase activity	IMP	28283184
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IDA	15652490
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15153556, 18607644, 24296617
GO:0048018	Function	Receptor ligand activity	IDA	24296617
GO:0048146	Process	Positive regulation of fibroblast proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	17906677
GO:0050729	Process	Positive regulation of inflammatory response	TAS	17159080
GO:0051387	Process	Negative regulation of neurotrophin TRK receptor signaling pathway	IDA	10406457
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	15652490
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070294	Process	Renal sodium ion absorption	IDA	35093948
GO:0070294	Process	Renal sodium ion absorption	ISS	14608358, 17975670
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IDA	18607644
GO:0090205	Process	Positive regulation of cholesterol metabolic process	IDA	18971559
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0110063	Process	Positive regulation of angiotensin-activated signaling pathway	IDA	25313067
GO:1901201	Process	Regulation of extracellular matrix assembly	IGI	17416596
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IDA	30729664
GO:1902306	Process	Negative regulation of sodium ion transmembrane transport	TAS	19193863
GO:1902632	Process	Positive regulation of membrane hyperpolarization	IMP	15803439, 17703433
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	30729664
GO:1903598	Process	Positive regulation of gap junction assembly	IGI	17416596
GO:1903779	Process	Regulation of cardiac conduction	IGI	17416596
GO:1990776	Process	Response to angiotensin	IBA
GO:1990776	Process	Response to angiotensin	IDA	30729664
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	17906677
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	10406457

MIM	HGNC	e!Ensembl
106150	333	ENSG00000135744

P01019

Protein name

Angiotensinogen (Serpin A8) [Cleaved into: Angiotensin-1 (Angiotensin 1-10) (Angiotensin I) (Ang I); Angiotensin-2 (Angiotensin 1-8) (Angiotensin II) (Ang II); Angiotensin-3 (Angiotensin 2-8) (Angiotensin III) (Ang III) (Des-Asp[1]-angiotensin II); Angiot

Protein function

Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. ; [Angioten

PDB

1N9U , 1N9V , 2JP8 , 2WXW , 2X0B , 3CK0 , 3WOO , 3WOR , 4AA1 , 4APH , 4FYS , 5E2Q , 5M3X , 5M3Y , 5XJM , 6I3F , 6I3I , 6JOD , 6OS0 , 7C6A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	108 → 481	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma. {ECO:0000269|PubMed:1692023}.

Sequence

MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA

Sequence length

485

Interactions

View interactions

100

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Anhydramnios	Likely pathogenic	rs2102791328, rs387906578	RCV001807655 RCV001807656	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Essential hypertension, genetic	Likely pathogenic; Pathogenic	rs778806374, rs747815674	RCV002496897 RCV002489210	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Large fontanelles	Likely pathogenic	rs2102791328, rs387906578	RCV001807655 RCV001807656	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal tubular dysgenesis	Likely pathogenic; Pathogenic	rs74315283, rs121912702, rs387906578, rs776421645	RCV000019696 RCV000019697 RCV000019698 RCV001175178	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal tubular dysgenesis of genetic origin	Likely pathogenic; Pathogenic	rs778806374, rs747815674	RCV002496897 RCV002489210	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (95)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AGT-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANURIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, ABDOMINAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISSECTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMIAS, CARDIAC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION OF AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FABRY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDRONEPHROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERHOMOCYSTEINEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension, essential, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, RENAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT HYPERTENSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DUCTAL ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POTASSIUM DEFICIENCY DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RENAL HYPERTENSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY OF PREMATURITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED ABDOMINAL AORTIC ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED AORTIC ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED THORACIC AORTIC ANEURYSM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICK SINUS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACOABDOMINAL AORTIC ANEURYSM, RUPTURED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR REMODELING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

AGT (angiotensinogen)