Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1906
Gene name	Endothelin 1
Gene symbol	EDN1
Synonyms (NCBI Gene)	ARCND3ET1HDLCQ7PPET1QME
Chromosome	6
Chromosome location	6p24.1
Summary	This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatme

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777231	A>G	Pathogenic	Missense variant, coding sequence variant
rs587777232	C>A	Pathogenic	Missense variant, coding sequence variant
rs587777233	T>A	Pathogenic	Missense variant, coding sequence variant
rs587777234	T>G	Pathogenic	Stop gained, coding sequence variant

387

Show/Hide all (387)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004455	hsa-miR-155-5p	Luciferase reporter assay	19783678
MIRT005432	hsa-miR-199a-5p	Luciferase reporter assay	19783678
MIRT006855	hsa-miR-1-3p	Luciferase reporter assay	22963810
MIRT006855	hsa-miR-1-3p	Luciferase reporter assay	22963810
MIRT022267	hsa-miR-124-3p	Microarray	18668037
MIRT006855	hsa-miR-1-3p	Microarray	18668037
MIRT006855	hsa-miR-1-3p	Luciferase reporter assayqRT-PCR	25394359
MIRT006855	hsa-miR-1-3p	MicroarrayELISAqRT-PCR	24394957
MIRT006855	hsa-miR-1-3p	MicroarrayELISAqRT-PCR	24394957
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT477747	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT477746	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT244069	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT244068	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT244067	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT244066	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT244065	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT244070	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT244074	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT244073	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT244075	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT244087	hsa-miR-4458	PAR-CLIP	23592263
MIRT244088	hsa-miR-4500	PAR-CLIP	23592263
MIRT244083	hsa-miR-4295	PAR-CLIP	23592263
MIRT244079	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT244085	hsa-miR-3666	PAR-CLIP	23592263
MIRT244081	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT244078	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT244076	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT244077	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT244086	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT244091	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT477745	hsa-miR-6074	PAR-CLIP	23592263
MIRT477744	hsa-miR-664a-3p	PAR-CLIP	23592263
MIRT244080	hsa-miR-759	PAR-CLIP	23592263
MIRT477743	hsa-miR-1279	PAR-CLIP	23592263
MIRT477742	hsa-miR-8060	PAR-CLIP	23592263
MIRT477741	hsa-miR-4769-3p	PAR-CLIP	23592263
MIRT477740	hsa-miR-6817-5p	PAR-CLIP	23592263
MIRT477739	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT244089	hsa-miR-4710	PAR-CLIP	23592263
MIRT244082	hsa-miR-1294	PAR-CLIP	23592263
MIRT244090	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT477738	hsa-miR-7154-5p	PAR-CLIP	23592263
MIRT477737	hsa-miR-433-3p	PAR-CLIP	23592263
MIRT378367	hsa-miR-4727-5p	PAR-CLIP	23592263
MIRT477736	hsa-miR-5001-3p	PAR-CLIP	23592263
MIRT378368	hsa-miR-6738-3p	PAR-CLIP	23592263
MIRT477735	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT006855	hsa-miR-1-3p	Luciferase reporter assayqRT-PCR	28042875
MIRT244073	hsa-miR-98-5p	Luciferase reporter assay	26098770
MIRT732169	hsa-miR-125a-5p	Luciferase reporter assay	27106952
MIRT732169	hsa-miR-125a-5p	Luciferase reporter assay	27106952
MIRT006855	hsa-miR-1-3p	ELISALuciferase reporter assayqRT-PCRWestern blot	28493075
MIRT006855	hsa-miR-1-3p	ELISALuciferase reporter assayqRT-PCRWestern blot	28493075
MIRT244076	hsa-miR-130a-3p	Luciferase reporter assayqRT-PCR	33314303
MIRT244078	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCR	33314303
MIRT244065	hsa-let-7a-5p	Luciferase reporter assayqRT-PCR	33314303
MIRT244066	hsa-let-7b-5p	Luciferase reporter assayqRT-PCR	33314303
MIRT244070	hsa-let-7f-5p	Luciferase reporter assayqRT-PCR	33314303
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT615489	hsa-miR-4328	HITS-CLIP	23824327
MIRT615488	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT615487	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT615486	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT615485	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT615484	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT615483	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT615482	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT615481	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT615480	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT615479	hsa-miR-507	HITS-CLIP	23824327
MIRT615478	hsa-miR-557	HITS-CLIP	23824327
MIRT615477	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT477747	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT477746	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT244069	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT244068	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT244067	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT244066	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT244065	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT244070	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT244074	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT244073	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT244075	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT244087	hsa-miR-4458	PAR-CLIP	23592263
MIRT244088	hsa-miR-4500	PAR-CLIP	23592263
MIRT244083	hsa-miR-4295	PAR-CLIP	23592263
MIRT244079	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT244085	hsa-miR-3666	PAR-CLIP	23592263
MIRT244081	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT244078	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT244076	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT244077	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT244086	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT244091	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT477745	hsa-miR-6074	PAR-CLIP	23592263
MIRT477744	hsa-miR-664a-3p	PAR-CLIP	23592263
MIRT244080	hsa-miR-759	PAR-CLIP	23592263
MIRT477743	hsa-miR-1279	PAR-CLIP	23592263
MIRT477742	hsa-miR-8060	PAR-CLIP	23592263
MIRT477741	hsa-miR-4769-3p	PAR-CLIP	23592263
MIRT477740	hsa-miR-6817-5p	PAR-CLIP	23592263
MIRT477739	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT244089	hsa-miR-4710	PAR-CLIP	23592263
MIRT244082	hsa-miR-1294	PAR-CLIP	23592263
MIRT244090	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT477738	hsa-miR-7154-5p	PAR-CLIP	23592263
MIRT477737	hsa-miR-433-3p	PAR-CLIP	23592263
MIRT378367	hsa-miR-4727-5p	PAR-CLIP	23592263
MIRT477736	hsa-miR-5001-3p	PAR-CLIP	23592263
MIRT378368	hsa-miR-6738-3p	PAR-CLIP	23592263
MIRT477735	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT006855	hsa-miR-1-3p	MicroarrayqRT-PCR	35899934
MIRT756052	hsa-miR-575	MicroarrayqRT-PCR	35899934
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952661	hsa-miR-1275	CLIP-seq
MIRT952662	hsa-miR-1298	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952665	hsa-miR-132	CLIP-seq
MIRT952666	hsa-miR-1909	CLIP-seq
MIRT952667	hsa-miR-194	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952669	hsa-miR-212	CLIP-seq
MIRT952670	hsa-miR-214	CLIP-seq
MIRT952671	hsa-miR-299-3p	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952674	hsa-miR-3134	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT952677	hsa-miR-3179	CLIP-seq
MIRT952678	hsa-miR-3202	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952680	hsa-miR-3619-5p	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT952685	hsa-miR-410	CLIP-seq
MIRT952686	hsa-miR-433	CLIP-seq
MIRT952687	hsa-miR-4426	CLIP-seq
MIRT952688	hsa-miR-4476	CLIP-seq
MIRT952689	hsa-miR-4525	CLIP-seq
MIRT952690	hsa-miR-4534	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952692	hsa-miR-4647	CLIP-seq
MIRT952693	hsa-miR-4648	CLIP-seq
MIRT952694	hsa-miR-4651	CLIP-seq
MIRT952695	hsa-miR-4654	CLIP-seq
MIRT952696	hsa-miR-4662b	CLIP-seq
MIRT952697	hsa-miR-4665-5p	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT952699	hsa-miR-4676-5p	CLIP-seq
MIRT952700	hsa-miR-4688	CLIP-seq
MIRT952701	hsa-miR-4699-5p	CLIP-seq
MIRT952702	hsa-miR-4723-5p	CLIP-seq
MIRT952703	hsa-miR-4747-5p	CLIP-seq
MIRT952704	hsa-miR-4769-5p	CLIP-seq
MIRT952705	hsa-miR-4786-3p	CLIP-seq
MIRT952706	hsa-miR-4802-5p	CLIP-seq
MIRT952707	hsa-miR-486-3p	CLIP-seq
MIRT952708	hsa-miR-494	CLIP-seq
MIRT756052	hsa-miR-575	CLIP-seq
MIRT952709	hsa-miR-584	CLIP-seq
MIRT952710	hsa-miR-608	CLIP-seq
MIRT952711	hsa-miR-625	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952713	hsa-miR-671-5p	CLIP-seq
MIRT952714	hsa-miR-761	CLIP-seq
MIRT952715	hsa-miR-765	CLIP-seq
MIRT952716	hsa-miR-802	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952661	hsa-miR-1275	CLIP-seq
MIRT952718	hsa-miR-1305	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952719	hsa-miR-185	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952720	hsa-miR-2113	CLIP-seq
MIRT952671	hsa-miR-299-3p	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952677	hsa-miR-3179	CLIP-seq
MIRT952678	hsa-miR-3202	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952721	hsa-miR-3659	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT952722	hsa-miR-4306	CLIP-seq
MIRT952686	hsa-miR-433	CLIP-seq
MIRT952688	hsa-miR-4476	CLIP-seq
MIRT952689	hsa-miR-4525	CLIP-seq
MIRT952690	hsa-miR-4534	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952723	hsa-miR-4644	CLIP-seq
MIRT952693	hsa-miR-4648	CLIP-seq
MIRT952695	hsa-miR-4654	CLIP-seq
MIRT952724	hsa-miR-4658	CLIP-seq
MIRT952725	hsa-miR-4663	CLIP-seq
MIRT952697	hsa-miR-4665-5p	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT952700	hsa-miR-4688	CLIP-seq
MIRT952726	hsa-miR-4693-3p	CLIP-seq
MIRT952702	hsa-miR-4723-5p	CLIP-seq
MIRT952727	hsa-miR-4758-5p	CLIP-seq
MIRT952704	hsa-miR-4769-5p	CLIP-seq
MIRT952728	hsa-miR-4775	CLIP-seq
MIRT952706	hsa-miR-4802-5p	CLIP-seq
MIRT952707	hsa-miR-486-3p	CLIP-seq
MIRT952708	hsa-miR-494	CLIP-seq
MIRT952729	hsa-miR-511	CLIP-seq
MIRT952730	hsa-miR-544	CLIP-seq
MIRT952731	hsa-miR-574-5p	CLIP-seq
MIRT952732	hsa-miR-590-3p	CLIP-seq
MIRT952711	hsa-miR-625	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952715	hsa-miR-765	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT952662	hsa-miR-1298	CLIP-seq
MIRT952666	hsa-miR-1909	CLIP-seq
MIRT952670	hsa-miR-214	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT952677	hsa-miR-3179	CLIP-seq
MIRT952678	hsa-miR-3202	CLIP-seq
MIRT1982109	hsa-miR-33a	CLIP-seq
MIRT1982110	hsa-miR-33b	CLIP-seq
MIRT952680	hsa-miR-3619-5p	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT1982111	hsa-miR-3684	CLIP-seq
MIRT1982112	hsa-miR-3975	CLIP-seq
MIRT952694	hsa-miR-4651	CLIP-seq
MIRT952700	hsa-miR-4688	CLIP-seq
MIRT952703	hsa-miR-4747-5p	CLIP-seq
MIRT952707	hsa-miR-486-3p	CLIP-seq
MIRT1982113	hsa-miR-499a-5p	CLIP-seq
MIRT952710	hsa-miR-608	CLIP-seq
MIRT1982114	hsa-miR-642b	CLIP-seq
MIRT952714	hsa-miR-761	CLIP-seq
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952662	hsa-miR-1298	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT1982109	hsa-miR-33a	CLIP-seq
MIRT1982110	hsa-miR-33b	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT1982111	hsa-miR-3684	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT1982112	hsa-miR-3975	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT1982113	hsa-miR-499a-5p	CLIP-seq
MIRT1982114	hsa-miR-642b	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT952653	hsa-let-7a	CLIP-seq
MIRT952654	hsa-let-7b	CLIP-seq
MIRT952655	hsa-let-7c	CLIP-seq
MIRT952656	hsa-let-7d	CLIP-seq
MIRT952657	hsa-let-7e	CLIP-seq
MIRT952658	hsa-let-7f	CLIP-seq
MIRT952659	hsa-let-7g	CLIP-seq
MIRT952660	hsa-let-7i	CLIP-seq
MIRT952663	hsa-miR-130a	CLIP-seq
MIRT952664	hsa-miR-130b	CLIP-seq
MIRT952668	hsa-miR-202	CLIP-seq
MIRT952672	hsa-miR-301a	CLIP-seq
MIRT952673	hsa-miR-301b	CLIP-seq
MIRT952675	hsa-miR-3153	CLIP-seq
MIRT952676	hsa-miR-3159	CLIP-seq
MIRT952679	hsa-miR-3529	CLIP-seq
MIRT952681	hsa-miR-3675-5p	CLIP-seq
MIRT952682	hsa-miR-3682-5p	CLIP-seq
MIRT1982111	hsa-miR-3684	CLIP-seq
MIRT952683	hsa-miR-379	CLIP-seq
MIRT952684	hsa-miR-3927	CLIP-seq
MIRT1982112	hsa-miR-3975	CLIP-seq
MIRT952686	hsa-miR-433	CLIP-seq
MIRT952691	hsa-miR-454	CLIP-seq
MIRT952698	hsa-miR-4668-5p	CLIP-seq
MIRT952708	hsa-miR-494	CLIP-seq
MIRT1982113	hsa-miR-499a-5p	CLIP-seq
MIRT952709	hsa-miR-584	CLIP-seq
MIRT1982114	hsa-miR-642b	CLIP-seq
MIRT952712	hsa-miR-664	CLIP-seq
MIRT952717	hsa-miR-98	CLIP-seq
MIRT2679769	hsa-miR-4729	CLIP-seq
MIRT2679770	hsa-miR-513c	CLIP-seq
MIRT2679771	hsa-miR-514b-5p	CLIP-seq
MIRT2679772	hsa-miR-579	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
FOXO1	Unknown	19887561
HIF1A	Activation	19783678
JUN	Unknown	12208352
NFKB1	Unknown	21334436
NR1H4	Repression	16357303
RELA	Unknown	21334436
STAT1	Activation	20217138

183

Show/Hide all (183)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19767294
GO:0000165	Process	MAPK cascade	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001821	Process	Histamine secretion	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0003015	Process	Heart process	IEA
GO:0003094	Process	Glomerular filtration	IEA
GO:0003100	Process	Regulation of systemic arterial blood pressure by endothelin	IBA
GO:0003100	Process	Regulation of systemic arterial blood pressure by endothelin	IDA	2649896
GO:0003253	Process	Cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA
GO:0003357	Process	Noradrenergic neuron differentiation	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IDA	19767294
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	2649896, 10770212
GO:0005515	Function	Protein binding	IPI	17446437, 23597562
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10770212, 15691296, 16820593
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	12379507
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IBA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	30990108
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006885	Process	Regulation of pH	IEA
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	1713452
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17078114
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007267	Process	Cell-cell signaling	IDA	12379507
GO:0007411	Process	Axon guidance	IEA
GO:0007507	Process	Heart development	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0007589	Process	Body fluid secretion	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	1917960, 17078114
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0010193	Process	Response to ozone	IEA
GO:0010460	Process	Positive regulation of heart rate	IDA	2649896
GO:0010467	Process	Gene expression	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	TAS	8999856
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IDA	12847114
GO:0010629	Process	Negative regulation of gene expression	IDA	16820593
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010827	Process	Regulation of D-glucose transmembrane transport	IEA
GO:0014032	Process	Neural crest cell development	IEA
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0014034	Process	Neural crest cell fate commitment	IEA
GO:0014823	Process	Response to activity	IEA
GO:0014824	Process	Artery smooth muscle contraction	IDA	8982507
GO:0014824	Process	Artery smooth muscle contraction	IEA
GO:0014824	Process	Artery smooth muscle contraction	TAS	1725334
GO:0014826	Process	Vein smooth muscle contraction	IBA
GO:0014826	Process	Vein smooth muscle contraction	IDA	9422810
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	10770212
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	16820593
GO:0030072	Process	Peptide hormone secretion	IDA	10770212
GO:0030133	Component	Transport vesicle	TAS
GO:0030185	Process	Nitric oxide transport	IDA	16820593
GO:0030195	Process	Negative regulation of blood coagulation	TAS	16820593
GO:0030335	Process	Positive regulation of cell migration	IDA	9696419
GO:0030593	Process	Neutrophil chemotaxis	IDA	9696419
GO:0030878	Process	Thyroid gland development	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IDA	9492062
GO:0031583	Process	Phospholipase D-activating G protein-coupled receptor signaling pathway	IEA
GO:0031707	Function	Endothelin A receptor binding	IBA
GO:0031707	Function	Endothelin A receptor binding	IDA	10770212
GO:0031707	Function	Endothelin A receptor binding	IEA
GO:0031708	Function	Endothelin B receptor binding	IBA
GO:0031708	Function	Endothelin B receptor binding	IDA	10770212
GO:0031708	Function	Endothelin B receptor binding	IEA
GO:0031708	Function	Endothelin B receptor binding	IPI	1713452
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033093	Component	Weibel-Palade body	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0034696	Process	Response to prostaglandin F	IEA
GO:0035050	Process	Embryonic heart tube development	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0035994	Process	Response to muscle stretch	IEA
GO:0042045	Process	Epithelial fluid transport	IEA
GO:0042310	Process	Vasoconstriction	IDA	2649896, 11410113
GO:0042310	Process	Vasoconstriction	IEA
GO:0042474	Process	Middle ear morphogenesis	IEA
GO:0042482	Process	Positive regulation of odontogenesis	IEA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043179	Process	Rhythmic excitation	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10770212, 12847114
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	17078114
GO:0044321	Process	Response to leptin	IEA
GO:0044751	Process	Cellular response to human chorionic gonadotropin stimulus	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0045321	Process	Leukocyte activation	TAS	16820593
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	TAS	8999856
GO:0045793	Process	Positive regulation of cell size	IDA	12847114
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	10770212
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24117217
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IBA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	12847114
GO:0046887	Process	Positive regulation of hormone secretion	IDA	10770212
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048237	Component	Rough endoplasmic reticulum lumen	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10393673
GO:0048675	Process	Axon extension	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	1917960
GO:0051216	Process	Cartilage development	IEA
GO:0051248	Process	Negative regulation of protein metabolic process	IDA	19767294
GO:0051899	Process	Membrane depolarization	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060137	Process	Maternal process involved in parturition	IEA
GO:0060298	Process	Positive regulation of sarcomere organization	IMP	12847114
GO:0060385	Process	Axonogenesis involved in innervation	IEA
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IDA	24117217
GO:0061051	Process	Positive regulation of cell growth involved in cardiac muscle cell development	IGI	24117217
GO:0061626	Process	Pharyngeal arch artery morphogenesis	IEA
GO:0070101	Process	Positive regulation of chemokine-mediated signaling pathway	IDA	17178876
GO:0070294	Process	Renal sodium ion absorption	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	30990108
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA
GO:0071373	Process	Cellular response to luteinizing hormone stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071389	Process	Cellular response to mineralocorticoid stimulus	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0072011	Process	Glomerular endothelium development	IEA
GO:0072112	Process	Podocyte differentiation	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IDA	9492062, 16820593
GO:0086100	Process	Endothelin receptor signaling pathway	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031
GO:0086101	Process	Endothelin receptor signaling pathway involved in heart process	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097237	Process	Cellular response to toxic substance	IDA	30990108
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0097492	Process	Sympathetic neuron axon guidance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0141156	Process	CAMP/PKA signal transduction	IDA	30990108
GO:0160195	Process	Negative regulation of phospholipase C/protein kinase C signal transduction	IDA	16820593
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1902074	Process	Response to salt	IEA
GO:1902287	Process	Semaphorin-plexin signaling pathway involved in axon guidance	IEA
GO:1903537	Process	Meiotic cell cycle process involved in oocyte maturation	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1905653	Process	Positive regulation of artery morphogenesis	IEA
GO:2001259	Process	Positive regulation of cation channel activity	IDA	30990108

MIM	HGNC	e!Ensembl
131240	3176	ENSG00000078401

P05305

Protein name

Endothelin-1 (Preproendothelin-1) (PPET1) [Cleaved into: Endothelin-1 (ET-1); Big endothelin-1]

Protein function

Endothelins are endothelium-derived vasoconstrictor peptides (By similarity). Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells (P

PDB

1EDN , 1EDP , 1T7H , 1V6R , 5GLH , 6DK5 , 8HCQ , 8HCX , 8IY5 , 8IY6 , 8XGR , 8XVE , 8XVH , 8XVI , 8XWP , 8XWQ , 8ZRT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00322	Endothelin	49 → 77	Endothelin family	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung, placental stem villi vessels and in cultured placental vascular smooth muscle cells. {ECO:0000269|PubMed:9284755}.

Sequence

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

Sequence length

212

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Auriculocondylar syndrome 3	Pathogenic	rs587777231, rs587777232	RCV000106312 RCV000106313	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Question mark ears, isolated	Pathogenic	rs587777233, rs587777234	RCV000106314 RCV000106315	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (76)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARRHYTHMIAS, CARDIAC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS OF AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURICULO-CONDYLAR SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AURICULOCONDYLAR SYNDROME	—	CTD, Orphanet CTD, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIOLITIS OBLITERANS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARTILAGE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF OPTIC NERVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDN1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High density lipoprotein cholesterol level quantitative trait locus 7	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER, OVERACTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY RETENTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (647)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	35468098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	20083630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	24035903, 28038820, 28712433, 28942357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Inflammatory Demyelinating Polyneuropathy	Inflammatory Demyelinating Polyneuropathy	BEFREE	29137897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	9788586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11746273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11711511, 7504041, 7721442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	7504041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	11078430, 12193050, 15702240, 9322959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17235729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19541930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30971910, 31522299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24423643, 27814735, 28285347, 30150298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27814735, 30150298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28566491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25403488, 28548215, 34956203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	7635951	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	17373676, 26460070, 27573019, 27612006, 28466542, 28548215, 29545351, 30144292, 31273050, 31505241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	8301307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	9588730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26322793, 27749683, 28302570, 28539637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26322793, 27749683, 28302570, 28539637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	23887640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	BEFREE	30650250, 30970525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	18623111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	10400911, 35181609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	19008257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	12529269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	28429342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	31637257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	22633685, 25486928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10069781, 10473669, 11044782, 11162610, 12193044, 14593587, 15838357, 17525706, 19672034, 21451528, 22321643, 23887640, 24877885, 27682654, 29207193 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	9734624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	30826900, 31770577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10200023, 11668616, 11991554, 17470272, 17960156, 17996929, 23448392, 30737857, 31744482, 9701415		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16920889, 17470272, 19247692, 19371341, 21103062, 9701415	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	16981460		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	17960156, 17996929		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26071554	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	16007684, 7609093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	16007684, 8664342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	24136229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10069781, 10473669, 11162610, 12193044, 14593587, 15838357, 17525706, 19672034, 21451528, 22082065, 22321643, 23887640, 24877885, 27682654, 29207193 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15838299, 15838357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15863881, 19672034, 22321643, 24607773, 29654172, 35527471, 40076930, 9786493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	16762801		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20495015, 28587741, 28886122, 29049685, 29529394, 30513109, 30626765, 30954598, 31117937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	20495015	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	28701603, 29940585, 30513109, 34332113	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Standstill	Atrial standstill	Pubtator	20495015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Auriculo-condylar syndrome	Auriculocondylar syndrome	BEFREE	24268655, 28328130		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auriculo-condylar syndrome	Auriculocondylar syndrome	ORPHANET_DG	24268655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auriculo-condylar syndrome	Auriculocondylar syndrome	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auriculo-condylar syndrome	Auriculocondylar syndrome	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auriculocondylar syndrome	Auriculocondylar Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Auriculocondylar syndrome 1	Auriculocondylar Syndrome	GENOMICS_ENGLAND_DG	24268655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Auriculocondylar syndrome 1	Auriculocondylar Syndrome	BEFREE	28456137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Auriculocondylar syndrome 1	Auriculocondylar Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Auriculocondylar syndrome 1	Auriculocondylar Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
AURICULOCONDYLAR SYNDROME 3	Auriculocondylar Syndrome	UNIPROT_DG	24268655		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AURICULOCONDYLAR SYNDROME 3	Auriculocondylar Syndrome	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	30584959		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28587387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23384184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	15946241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	22553222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	9496898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	BEFREE	7472910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15643502, 17549358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18945538, 20663522, 21183790, 27683119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10917552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	32383346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	10917552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	9453574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	22633685, 36007264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	31553988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	10700441, 22997346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10672062, 15226779, 17295044, 19943105, 23660387, 24373848, 26607335, 28613020, 29566737, 31079185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15226779, 16984733, 22006997, 24373848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	10933101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis obliterans	Pubtator	21078427	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis Chronic	Bronchitis	Pubtator	21932697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	26176954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36475746, 7560095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17241596	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	17158636	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26420968, 35896520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	24373848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18945538, 20663522, 21183790, 27683119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28599441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24530737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15139053, 24136229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29630085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25946671		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12193113, 16357176, 16648553, 16741062, 19010899, 20725137, 21220476, 24530737, 25194819, 26522724, 26909598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	10400911, 32878883	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomegaly	Cardiomegaly	Pubtator	36544188	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	11589785		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	14718401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	11589785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16095497, 20495015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	16920889, 32878883, 33582159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	10217651, 14718401, 25042451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10217651, 10529327, 10700441, 25042451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	CTD_human_DG	20707411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	35205232	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	10077237, 21777246, 23315480, 26573599, 30753341	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15759050, 20083432, 20217138, 22396501, 26211713, 26607335, 27102411, 27682654, 27736201, 28230089, 28635124, 28686356, 28726796, 28790330, 29354880 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	16332659		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21057729	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22971991	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	BEFREE	31606133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	14558091, 15743480, 23565184	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cartilage Diseases	Cartilage Diseases	CTD_human_DG	20707411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Nervous System Diseases	Central nervous system disease	Pubtator	18379872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	32168316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27106952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31073782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	36384316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	22997346, 24852947, 30272323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	12855940, 18436890		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	19661472, 28302570, 28358140, 28703413, 28703856, 29190633, 29334831, 29468588, 29476447, 29489843, 29740308, 29778441, 30265150, 30888409, 31073782, 31227671, 31500524, 31733648 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	20083630		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	CTD_human_DG	17578707		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	19460784, 22527129, 28692114	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	21677282	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	29947530		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Insufficiency	Cerebrovascular Insufficiency	CTD_human_DG	17578707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Occlusion	Cerebrovascular Occlusion	CTD_human_DG	17578707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11053249, 12193050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	30020318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	11991554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22021908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, progressive familial intrahepatic 1	Intrahepatic cholestasis	BEFREE	7472910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondromalacia	Chondromalacia	CTD_human_DG	20707411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	21959927, 23523690, 23584483, 27602960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27602960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12193050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	10217651, 12565798, 18442814, 18953265, 28694457, 9546947, 9794709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11071967, 16943682, 21894000, 28882114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	11071967, 22068875, 25572710, 28005706, 29587563, 29743680, 29947528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24901342, 28092772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18822124		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19640695, 20707291, 21434478, 22165675, 28729387, 29468936, 30114262		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	11210078, 12193115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chuvash erythrocytosis	Chuvash Erythrocytosis	BEFREE	16769575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10796886, 7472910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	34032749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	29453306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30273663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36384316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12193050, 15558022, 21445967, 22865632, 24628039, 30444664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15558022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24628039, 28708138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11034585, 12521131, 28249901, 28708138, 30444664, 36453252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11742499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common ventricle	Complete Atrioventricular Canal Defect	BEFREE	18603063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	17016610, 8988087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	15546126, 29216632, 9473106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	9671575		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	29444773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10217651, 10816056, 11641245, 11708807, 12193094, 12565798, 14718401, 14729437, 16855133, 18218981, 18442814, 18923236, 18953265, 20495015, 25042451 View all (19 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	11136700, 11707688, 16360360, 16762801, 7967349, 7969316, 9861300		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conn Syndrome	Conn Syndrome	BEFREE	19073831, 31230554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15139053, 16581180, 24136229, 30895194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	32016117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	26573609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	27885846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10069781, 10378508, 11780050, 12574792, 17357073, 18923236, 19672034, 21267513, 28038820, 28323857, 28942357, 29151120, 29654172, 29743680, 30213784, 30621952, 31069633, 31214281 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10069781, 10378508, 12574792, 17357073, 17618613, 18923236, 19672034, 21267513, 27885846, 28038820, 28942357, 29654172, 29743680, 30213784, 30621952		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	11087242	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	17264805, 18923236		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	19672034, 29654172, 30621952, 30994493, 31972008, 32499477, 35801781, 9786493	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	BEFREE	30765295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Dissection Spontaneous	Spontaneous coronary artery dissection	Pubtator	30621952, 31707208, 33866193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	19012521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26573599, 31972008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10069781, 10378508, 12574792, 17357073, 18923236, 19672034, 21267513, 28038820, 28942357, 29654172, 29743680, 30621952		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing Syndrome	Cushing syndrome	Pubtator	31909455	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	30272323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	LHGDN	15838337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19460784, 39543807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	12629276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29266445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10090156, 14558091, 15743480, 21890279, 26934912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	14558091, 15743480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	27106952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28407377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28407377, 31025223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	12722924, 30095297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26322793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	25903653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25903653, 28586781, 28960333, 31128202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	25946671, 28960333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11358684, 12477147, 12954590, 15010576, 18806884, 18974277, 19391127, 20217138, 20628425, 23077601, 24394957, 25584774, 27102411, 29870994, 29947530 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11358684, 12477147, 12954590, 15010576, 18442814, 18806884, 18974277, 19391127, 20217138, 20497976, 20628425, 22972845, 23077601, 24394957, 25584774 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15863881, 18806884, 19421330, 20664700, 21169360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22326504, 22972845, 25104521, 35468098	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18806884, 20664700, 24607773, 26190179, 27789766, 39217825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19581418	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28544968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10450377, 10969841, 11358684, 11399938, 18806884, 19581418, 20664700, 23329136, 26710051, 27752839, 27789766, 28667102, 29654829, 29806659, 30849412		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16387788		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	20628425, 26710051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	19391127, 20497976, 30482051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	26710051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	19415232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	22250646	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19415232, 23077601, 27899487, 30926764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	10450377, 17967707, 18806884, 20664700, 30372743		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	18806884		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	18806884, 20664700	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	12628714	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	8587340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	24291390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31641998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ear Diseases	Ear Diseases	BEFREE	19358249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10585897, 11593097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25903653, 28586781, 28960333, 31128202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	20055806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	21932697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	12807444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	14499284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endemic goiter	Endemic Goiter	LHGDN	12746758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	1587391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	1732042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36542159, 7819049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29034546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29034546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	17290206, 29351334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21220476, 24530737, 26522724, 26909598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	CTD_human_DG	12002441		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erectile dysfunction	Erectile Dysfunction	BEFREE	27145076, 8858394		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17663518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17663518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	23384184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	32947843	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	14616768, 15188945, 15505112, 17525706, 28692114, 30359461, 7496057, 7768553, 8587478, 9050971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	28692114, 35645613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	15988412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	11078428, 22553222, 30301761, 7958393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	30621952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29129515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28238769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	16191423		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29137483, 31402170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	21757643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	CTD_human_DG	16324314		★★★★★ ★☆☆☆☆ Found in Text Mining only
GALACTOSIALIDOSIS	Galactosialidosis	BEFREE	7822272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	LHGDN	15838334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	32947843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	CTD_human_DG	16324314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28232168, 28606962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	28606962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	12692512, 15988412, 18420197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	15988412, 16123422, 18516102, 29676937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	17433294, 30950963, 9493554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11078429, 11092528, 12193050, 14499284, 16007684, 16720059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11092528, 16007684, 36766848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16720059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11078429, 11092528, 12193050, 14499284, 16007684, 16720059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	29947545		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	31734650, 34020533, 36796652	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	16928614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	17328840, 22250646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29137483	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	10541216, 16855133, 24590287, 27899487, 30990410, 9077548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glossoptosis	Glossoptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	31777301	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	32251485	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24291390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	12746758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24815860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	18603063, 21498912, 26617785, 27450023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	10700441, 20335527, 26260101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	12011762, 15838369, 20495015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	15817494, 15838369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31199841	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10816056, 11641245, 12193094, 14718401, 16855133, 18218981, 18953265, 20495015, 25042451, 27629528, 28398455, 28491088, 29390406, 29470978, 29872396 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	10816056, 11278891, 18953265, 9588211	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	11136700, 11707688, 16360360, 16762801, 7967349, 7969316, 9861300		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	LHGDN	16095497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	20495015, 22615818	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	11136700, 11707688, 16360360, 16762801, 7967349, 7969316, 9861300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	29151120, 31152133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	24896159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	19180125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	28095606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30920976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	CTD_human_DG	7967349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26543229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	22508396, 22984459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyalinosis, Segmental Glomerular	Glomerular Hyalinosis	CTD_human_DG	16191423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	9415517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	Pubtator	29028084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	23077601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	8083364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	28120456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	15486036		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	15662225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16428915, 18670619, 31088854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	18974277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33147748	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33967958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	27796268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	33967958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	15662225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphenylalaninemia, Non-Phenylketonuric	Hyperphenylalaninemia	BEFREE	12925450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	28857396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	28606962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	10438717, 15188945, 15369130, 18603063, 18806884, 19421330, 19672034, 20495015, 21757643, 28692114, 30753341, 34895646, 35205232, 35645613, 35981003, 9734624, 9787140 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	19653178, 26206738	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Portal	Portal hypertension	Pubtator	24507687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	18822124, 20335527, 25403488, 27425626, 28514291, 34011397, 35186226, 36179900, 8497283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10069781, 10090337, 10192234, 10473669, 10541216, 11230310, 11391651, 11425780, 11472982, 12391278, 12511547, 12925450, 12963677, 15148269, 15188945 View all (80 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	10474778, 10669576, 11847185, 12149661, 12425201, 12600921, 15188945, 15302986, 15314687, 15834289, 17130675, 7721406, 8152482, 8440307		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12013496, 12511547, 15194301, 15505112, 16778329, 17444275, 17938376, 18568290, 18772174, 18822124		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive Retinopathy	Hypertensive Retinopathy	BEFREE	30651821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	30513109, 9291833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	30513109	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	25358972, 25389285, 28587741, 30626765, 31117937, 9444881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	25389285, 28587741, 31117937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16920889, 35017014, 36977605	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	20495015	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	15188945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	29089036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic Left Heart Syndrome	BEFREE	18603063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic Left Heart Syndrome	LHGDN	18603063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	18603063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	15188945	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	11278891, 12963716, 24933425, 25138825, 30237409, 30301761, 31116583, 34942165, 8901607, 9588211	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15646831, 22552325, 24373848, 31734650, 36141455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29360807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	16813666, 21773759, 21838752, 22688668, 22960172, 24951762, 26098770, 26248159, 26252367, 26959484, 28181133, 28447910, 28593996, 28608969, 29064353 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20055532, 9032126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22527129, 32899090, 7615852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17267549, 22688668, 28039519, 31396496		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11598389, 17328840, 29137483		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	17328840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	9855375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30273663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	17197033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20188614, 21637825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21637825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25903653, 28960333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30237409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23565184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	23399038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	39215680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformation	Intracranial Arteriovenous Malformation	BEFREE	8988087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24633486, 27106952, 27452210, 28261086, 28302570, 29893190, 30047329, 30658953, 30731155, 31150867, 31566901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11238033, 12875994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	17241596	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	10399635, 15106802, 8604712		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	11358684, 14514737, 15855633, 16943682, 18923236, 21406182, 28698270, 29246686, 30144292, 9077548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	17328840, 17706018, 22250646, 28060893, 9734624	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	CTD_human_DG	7967349		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	16526315, 28882114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31777301	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	12973116, 28388547, 30185506, 30229506, 31290588, 9694958		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	9788586		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	11071967, 16943682, 21894000, 25572710, 28882114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	30116406	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	10601118, 15486036		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	15188945, 15505112, 17335511, 27810862, 9444881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	15505112		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	11136700, 11707688, 16360360, 16762801, 7967349, 7969316, 9861300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	15140230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17716379, 25138825, 34942165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24901342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	27664989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	19276553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	BEFREE	24521289		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	24416389, 26501871, 26607335, 28587387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10796886, 7472910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28606962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28542386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	7615814	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	16971893, 27777505, 28306361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	20082271, 27381367, 9284832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23056449, 9284832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15646831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	2231187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28153500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37749230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18991188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30157717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30755145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	30279475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29630085	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36475746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24373848, 26607335, 28613020, 29566737, 31079185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	1732042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11709722, 28599441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12193113, 16357176, 16648553, 16741062, 19010899, 20725137, 25194819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10917552, 11709722, 11746273, 17415380, 20663522, 20949559, 21365649, 29441862, 8988036, 9809984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25394359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24332749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18945538, 20663522, 21183790, 27683119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12919159, 15558022, 16648553, 16741062, 17130294, 21183790, 21491424, 21656314, 22865632, 25556429, 25627007, 26607335, 28092772, 28587387, 28694457, 30411193, 30919368 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15558022, 21445967, 22865632, 24628039, 30444664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14519635, 15073116, 18550016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial dysostosis	Pubtator	7750653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal ulcer	Marginal Ulcer	CTD_human_DG	16384872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	26825037, 29138054		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10383740, 12230494, 15610525, 15838263, 16720302, 26825037, 29947545, 30614626, 8198607		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12189238, 12230494, 15610525, 16098041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12189238, 12230494, 15610525, 16098041, 30614626, 8645250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	8645250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	8977712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	16007684, 17013629, 7560095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	16007684, 7560095, 7842471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26322793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	7822272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	7822272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27474839, 31529423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	12074801, 20725143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	11358684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microglossia	Microglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	26308584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	28819776, 30165438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	17197033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19661472, 29557064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	19558538, 29557064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19475602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28597546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28597546	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29137897, 30472305, 30871594, 31583031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	11589785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	11136700, 11707688, 16360360, 16762801, 7967349, 7969316, 9861300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10334806, 18442814, 19672034, 29151120, 29470978, 30213784, 30317569, 30656600, 31194009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12855940, 15161426, 17893002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35742539	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35886020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	10192234, 18442814, 28323857, 29151120, 31069633, 31214281		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	10462014, 11707688, 16306806		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	11278891, 19706169, 9588211	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	26190179	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	15759050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21487064, 23987636, 25237831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23987636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11053249, 12193050, 12875994, 15139053, 15226779, 15543524, 16007684, 16103083, 16741062, 17415380, 18457675, 18945538, 19010899, 20083228, 20725137 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	CTD_human_DG	7756592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	24747133		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	24747133, 31981468, 34895646	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	29360807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12193050, 22330820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16007684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28285347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	21406182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	26825037, 29138054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus, Blue	Blue Nevus	BEFREE	26825037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16596276		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28623618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	23401650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11934840, 15198485, 17242275, 18982011, 21926268, 28216625, 28289180, 28635124, 28705795, 28977804, 29996135, 30188800, 31147283, 31737180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	24063765	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	31147283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	31583031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	17433294, 18516102, 9493554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	23401650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	CTD_human_DG	16391412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	29518348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial cleft	Orofacial Cleft	BEFREE	11415518		★★★★★ ★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	11415518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14558091, 15743480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	24373848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21656314, 24069190, 24123836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21656314, 24069190, 24727660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	31079185		★★★★★ ★☆☆☆☆ Found in Text Mining only
OTOFACIOCERVICAL SYNDROME 1	Otofaciocervical Syndrome	BEFREE	11415518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12193113, 16357176, 16648553, 19010899, 20725137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	19202075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	31040646		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16357176, 16741062, 25194819, 26909598		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16648553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11073813, 12023962, 15347673, 22232246, 24530737, 25194819, 29482638, 31865146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	8198971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	12657945, 17575543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	8778321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12919159, 16712675, 24332749, 30411193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	19276553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	16762801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	9853913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	23384184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	CTD_human_DG	16384872		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periauricular skin pits	Periauricular skin pits	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	24877885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	37749230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	18447854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	18442814, 30988775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30988775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	7504041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pierre Robin Syndrome	Pierre-Robin Syndrome	BEFREE	28328130		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	11399938, 17290206, 28272719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	16526315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	LHGDN	12629276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30022320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	12629276, 16943682, 21894000, 30990410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22727793	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30847930, 31064393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31064393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	16769575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	9588730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	10796886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28407377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	20055806	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	11399938, 17290206, 28272719, 29351334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	18310504, 28634054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10917552, 11746273, 20663522, 20949559, 21365649, 29441862, 8988036, 9809984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	15621731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	9496898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10917552, 16026642, 18623111, 20725143, 25556429, 38087324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16026642, 16291872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18781169, 34165174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	16928614, 22250646, 40428357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	30809683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	9830808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12077518, 18031458, 25946671, 28937251, 28960333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	28937251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	29175309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	15695982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	16813666, 18822124, 19592490, 20190034, 22688668, 26252367, 28548215, 28608969, 29444773, 33611340, 37017914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20562228, 21773759, 22960172, 24951762, 26098770, 26252367, 28181133, 28548215, 29649319, 29710468, 29947527, 30260284, 30466619, 30911541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21498912, 22299030, 26617785	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18822124, 19640695, 21932697, 29444773, 30072506, 35186226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	22984459, 36141455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	36141455	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11000124, 15047866, 20055532, 22962065, 23306833, 26460070, 29131071, 29516177, 29947539, 30825198		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15044479, 16809784		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17235729		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Disease	Raynaud disease	Pubtator	37978357	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	31027378, 7944634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	12193050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12193050, 15139053, 16581180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17203161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29947534, 31843983, 9077548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	11675408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	9794709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	14514737, 31641998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CTD_human_DG	7967349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	29058246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	16625121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29058246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29058246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	16030497	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	LHGDN	18401297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10450377, 11358684, 18806884, 21406182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	28904960, 30025919, 30372743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29295858, 31099494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	11413193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	24896159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	36179900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10090156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18663623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	25301555, 29660902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	20082271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	23818101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	16447227, 28128745, 28831601, 9284832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	38324287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	14632763, 16813666, 26357964, 9284832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	17907149, 21496413, 26584613, 30157947, 31667578	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32947843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	11899142, 8977712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26071554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26071554, 26176954, 28840836, 30112039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen syndrome	Shprintzen Syndrome	BEFREE	8587340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	8587340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Single Ventricle Defect	Single Ventricle Defect	BEFREE	18603063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32517074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25946671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	17241596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	28514291, 31116583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	18580062, 20083432, 24010499, 28514291, 29107469, 29285176, 29896159, 30237409, 30511103, 31116583		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	18580062		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	7473647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	7473647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16217751, 19014602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25946671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30382525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	31069633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24416389, 29326427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	30672385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25394359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28493075, 36475746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36373306	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	10438717, 19661472	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	19661472	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	8988087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	17016610, 22997346, 24852947, 29438081, 29595109, 30272323, 30978262, 31387935, 9546947, 9607370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	LHGDN	17016610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	CTD_human_DG	8587695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	10090156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11231316, 14632763, 16447227, 16813666, 21068089, 22045841, 25990837, 26357964, 26970493, 28128745, 28320472, 28831601, 31667578, 7944634, 9284832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17291632, 18991099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	LHGDN	15838333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	31674930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Hydrocele	Testicular Hydrocele	BEFREE	21673044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	28259616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	28548215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12919159, 16712675, 24332749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24332749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	12919159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	30842488, 31569792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30842488, 31569792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22006997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22006997, 34326372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	21431856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	28168568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34286545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11078428, 22553222, 30301761, 7958393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	21601190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16879056, 26710051, 28168568, 28692114, 29947527, 30543947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24063765, 24376792, 24607773, 26308584, 27884380, 28753427, 29654172, 30621952, 30871567, 31230554, 31667578, 31909455, 31972008, 33967958, 40187599, 8497283 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24486907	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	19592490, 28606962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	21496413, 37749230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	22997346, 31595394, 36350075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vein of Galen aneurysm	Vein Of Galen Aneurysm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	27481876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	12011762, 15838369, 31214281, 31766450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	28575410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	29216383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	30116739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	15095274, 17576235		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	15095274, 17576235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	16030497	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	23283491	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

EDN1 (endothelin 1)