ADCY6 (adenylate cyclase 6)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 112
• Gene name: Adenylate cyclase 6
• Gene symbol: ADCY6
• Synonyms (NCBI Gene): AC6, LCCS8
• Chromosome: 12
• Chromosome location: 12q13.12
• Summary: This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic

miRNA Show/Hide all (486)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	20656788
MIRT016723	hsa-miR-335-5p	Microarray	18185580
MIRT022147	hsa-miR-124-3p	Microarray	18668037
MIRT001991	hsa-miR-96-5p	Sequencing	20371350
MIRT660903	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT660901	hsa-miR-3183	HITS-CLIP	23824327
MIRT660902	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT660900	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT660899	hsa-miR-4287	HITS-CLIP	23824327
MIRT660898	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT660897	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660896	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT660895	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT660903	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT660901	hsa-miR-3183	HITS-CLIP	23824327
MIRT660902	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT660900	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT660899	hsa-miR-4287	HITS-CLIP	23824327
MIRT660898	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT660897	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660896	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT660895	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT768036	hsa-miR-101	CLIP-seq
MIRT768037	hsa-miR-1224-3p	CLIP-seq
MIRT768038	hsa-miR-1260	CLIP-seq
MIRT768039	hsa-miR-1260b	CLIP-seq
MIRT768040	hsa-miR-128	CLIP-seq
MIRT768041	hsa-miR-1280	CLIP-seq
MIRT768042	hsa-miR-1285	CLIP-seq
MIRT768043	hsa-miR-1324	CLIP-seq
MIRT768044	hsa-miR-1914	CLIP-seq
MIRT768045	hsa-miR-1915	CLIP-seq
MIRT768046	hsa-miR-19a	CLIP-seq
MIRT768047	hsa-miR-19b	CLIP-seq
MIRT768048	hsa-miR-27a	CLIP-seq
MIRT768049	hsa-miR-27b	CLIP-seq
MIRT768050	hsa-miR-3148	CLIP-seq
MIRT768051	hsa-miR-3156-3p	CLIP-seq
MIRT768052	hsa-miR-3162-3p	CLIP-seq
MIRT768053	hsa-miR-3187-5p	CLIP-seq
MIRT768054	hsa-miR-3202	CLIP-seq
MIRT768055	hsa-miR-345	CLIP-seq
MIRT768056	hsa-miR-3945	CLIP-seq
MIRT768057	hsa-miR-4253	CLIP-seq
MIRT768058	hsa-miR-4301	CLIP-seq
MIRT768059	hsa-miR-4316	CLIP-seq
MIRT768060	hsa-miR-4668-5p	CLIP-seq
MIRT768061	hsa-miR-4684-5p	CLIP-seq
MIRT768062	hsa-miR-4726-3p	CLIP-seq
MIRT768063	hsa-miR-4747-5p	CLIP-seq
MIRT768064	hsa-miR-486-3p	CLIP-seq
MIRT768065	hsa-miR-490-3p	CLIP-seq
MIRT768066	hsa-miR-5096	CLIP-seq
MIRT768067	hsa-miR-513a-5p	CLIP-seq
MIRT768068	hsa-miR-532-3p	CLIP-seq
MIRT768069	hsa-miR-583	CLIP-seq
MIRT768070	hsa-miR-612	CLIP-seq
MIRT768071	hsa-miR-759	CLIP-seq
MIRT768036	hsa-miR-101	CLIP-seq
MIRT768072	hsa-miR-1197	CLIP-seq
MIRT768073	hsa-miR-1264	CLIP-seq
MIRT768040	hsa-miR-128	CLIP-seq
MIRT768042	hsa-miR-1285	CLIP-seq
MIRT768074	hsa-miR-140-5p	CLIP-seq
MIRT768075	hsa-miR-1909	CLIP-seq
MIRT768045	hsa-miR-1915	CLIP-seq
MIRT768076	hsa-miR-197	CLIP-seq
MIRT768077	hsa-miR-2110	CLIP-seq
MIRT768048	hsa-miR-27a	CLIP-seq
MIRT768049	hsa-miR-27b	CLIP-seq
MIRT768078	hsa-miR-3117-5p	CLIP-seq
MIRT768079	hsa-miR-3126-3p	CLIP-seq
MIRT768050	hsa-miR-3148	CLIP-seq
MIRT768080	hsa-miR-3153	CLIP-seq
MIRT768052	hsa-miR-3162-3p	CLIP-seq
MIRT768081	hsa-miR-3173-3p	CLIP-seq
MIRT768053	hsa-miR-3187-5p	CLIP-seq
MIRT768082	hsa-miR-3199	CLIP-seq
MIRT768054	hsa-miR-3202	CLIP-seq
MIRT768083	hsa-miR-323-3p	CLIP-seq
MIRT768084	hsa-miR-331-3p	CLIP-seq
MIRT768085	hsa-miR-361-3p	CLIP-seq
MIRT768086	hsa-miR-3679-3p	CLIP-seq
MIRT768087	hsa-miR-3921	CLIP-seq
MIRT768088	hsa-miR-3922-5p	CLIP-seq
MIRT768089	hsa-miR-3936	CLIP-seq
MIRT768090	hsa-miR-3938	CLIP-seq
MIRT768056	hsa-miR-3945	CLIP-seq
MIRT768091	hsa-miR-409-5p	CLIP-seq
MIRT768057	hsa-miR-4253	CLIP-seq
MIRT768092	hsa-miR-4271	CLIP-seq
MIRT768093	hsa-miR-4286	CLIP-seq
MIRT768094	hsa-miR-4303	CLIP-seq
MIRT768059	hsa-miR-4316	CLIP-seq
MIRT768095	hsa-miR-4436a	CLIP-seq
MIRT768096	hsa-miR-4438	CLIP-seq
MIRT768097	hsa-miR-4446-5p	CLIP-seq
MIRT768098	hsa-miR-4457	CLIP-seq
MIRT768099	hsa-miR-4475	CLIP-seq
MIRT768100	hsa-miR-4476	CLIP-seq
MIRT768101	hsa-miR-4496	CLIP-seq
MIRT768102	hsa-miR-4515	CLIP-seq
MIRT768103	hsa-miR-4653-5p	CLIP-seq
MIRT768104	hsa-miR-4667-3p	CLIP-seq
MIRT768105	hsa-miR-4667-5p	CLIP-seq
MIRT768061	hsa-miR-4684-5p	CLIP-seq
MIRT768106	hsa-miR-4700-5p	CLIP-seq
MIRT768107	hsa-miR-4725-3p	CLIP-seq
MIRT768062	hsa-miR-4726-3p	CLIP-seq
MIRT768108	hsa-miR-4786-3p	CLIP-seq
MIRT768109	hsa-miR-4802-3p	CLIP-seq
MIRT768065	hsa-miR-490-3p	CLIP-seq
MIRT768110	hsa-miR-501-3p	CLIP-seq
MIRT768111	hsa-miR-502-3p	CLIP-seq
MIRT768066	hsa-miR-5096	CLIP-seq
MIRT768067	hsa-miR-513a-5p	CLIP-seq
MIRT768112	hsa-miR-513b	CLIP-seq
MIRT768113	hsa-miR-518d-5p	CLIP-seq
MIRT768114	hsa-miR-519b-5p	CLIP-seq
MIRT768115	hsa-miR-519c-5p	CLIP-seq
MIRT768116	hsa-miR-520c-5p	CLIP-seq
MIRT768117	hsa-miR-526a	CLIP-seq
MIRT768118	hsa-miR-570	CLIP-seq
MIRT768070	hsa-miR-612	CLIP-seq
MIRT768119	hsa-miR-637	CLIP-seq
MIRT768120	hsa-miR-671-5p	CLIP-seq
MIRT768121	hsa-miR-875-3p	CLIP-seq
MIRT1926531	hsa-miR-1205	CLIP-seq
MIRT768037	hsa-miR-1224-3p	CLIP-seq
MIRT1926532	hsa-miR-125a-3p	CLIP-seq
MIRT768038	hsa-miR-1260	CLIP-seq
MIRT768039	hsa-miR-1260b	CLIP-seq
MIRT1926533	hsa-miR-1271	CLIP-seq
MIRT768041	hsa-miR-1280	CLIP-seq
MIRT768043	hsa-miR-1324	CLIP-seq
MIRT1926534	hsa-miR-136	CLIP-seq
MIRT1926535	hsa-miR-146b-3p	CLIP-seq
MIRT1926536	hsa-miR-182	CLIP-seq
MIRT1926537	hsa-miR-204	CLIP-seq
MIRT1926538	hsa-miR-211	CLIP-seq
MIRT1926539	hsa-miR-3064-3p	CLIP-seq
MIRT1926540	hsa-miR-3125	CLIP-seq
MIRT1926541	hsa-miR-3130-5p	CLIP-seq
MIRT1926542	hsa-miR-3138	CLIP-seq
MIRT1926543	hsa-miR-3154	CLIP-seq
MIRT1926544	hsa-miR-3173-5p	CLIP-seq
MIRT1926545	hsa-miR-3180-5p	CLIP-seq
MIRT1926546	hsa-miR-320e	CLIP-seq
MIRT768055	hsa-miR-345	CLIP-seq
MIRT1926547	hsa-miR-3616-3p	CLIP-seq
MIRT1926548	hsa-miR-3665	CLIP-seq
MIRT1926549	hsa-miR-3688-3p	CLIP-seq
MIRT1926550	hsa-miR-3911	CLIP-seq
MIRT1926551	hsa-miR-3916	CLIP-seq
MIRT1926552	hsa-miR-4257	CLIP-seq
MIRT1926553	hsa-miR-4261	CLIP-seq
MIRT1926554	hsa-miR-4267	CLIP-seq
MIRT1926555	hsa-miR-4270	CLIP-seq
MIRT1926556	hsa-miR-4313	CLIP-seq
MIRT1926557	hsa-miR-4318	CLIP-seq
MIRT1926558	hsa-miR-4436b-3p	CLIP-seq
MIRT1926559	hsa-miR-4441	CLIP-seq
MIRT1926560	hsa-miR-4455	CLIP-seq
MIRT1926561	hsa-miR-4482	CLIP-seq
MIRT1926562	hsa-miR-4520a-3p	CLIP-seq
MIRT1926563	hsa-miR-4536	CLIP-seq
MIRT1926564	hsa-miR-4685-5p	CLIP-seq
MIRT1926565	hsa-miR-4689	CLIP-seq
MIRT1926566	hsa-miR-4708-5p	CLIP-seq
MIRT1926567	hsa-miR-4713-3p	CLIP-seq
MIRT1926568	hsa-miR-4717-3p	CLIP-seq
MIRT1926569	hsa-miR-4721	CLIP-seq
MIRT1926570	hsa-miR-4800-5p	CLIP-seq
MIRT768109	hsa-miR-4802-3p	CLIP-seq
MIRT1926571	hsa-miR-494	CLIP-seq
MIRT1926572	hsa-miR-515-5p	CLIP-seq
MIRT768068	hsa-miR-532-3p	CLIP-seq
MIRT1926573	hsa-miR-542-5p	CLIP-seq
MIRT1926574	hsa-miR-543	CLIP-seq
MIRT1926575	hsa-miR-657	CLIP-seq
MIRT1926576	hsa-miR-874	CLIP-seq
MIRT1926577	hsa-miR-96	CLIP-seq
MIRT768036	hsa-miR-101	CLIP-seq
MIRT768037	hsa-miR-1224-3p	CLIP-seq
MIRT2167516	hsa-miR-1245	CLIP-seq
MIRT768038	hsa-miR-1260	CLIP-seq
MIRT768039	hsa-miR-1260b	CLIP-seq
MIRT768040	hsa-miR-128	CLIP-seq
MIRT768041	hsa-miR-1280	CLIP-seq
MIRT2167517	hsa-miR-1286	CLIP-seq
MIRT768043	hsa-miR-1324	CLIP-seq
MIRT2167518	hsa-miR-135a	CLIP-seq
MIRT2167519	hsa-miR-135b	CLIP-seq
MIRT2167520	hsa-miR-185	CLIP-seq
MIRT2167521	hsa-miR-1913	CLIP-seq
MIRT768076	hsa-miR-197	CLIP-seq
MIRT1926537	hsa-miR-204	CLIP-seq
MIRT1926538	hsa-miR-211	CLIP-seq
MIRT768077	hsa-miR-2110	CLIP-seq
MIRT768048	hsa-miR-27a	CLIP-seq
MIRT768049	hsa-miR-27b	CLIP-seq
MIRT1926539	hsa-miR-3064-3p	CLIP-seq
MIRT2167522	hsa-miR-3064-5p	CLIP-seq
MIRT2167523	hsa-miR-31	CLIP-seq
MIRT1926540	hsa-miR-3125	CLIP-seq
MIRT2167524	hsa-miR-3126-5p	CLIP-seq
MIRT2167525	hsa-miR-3127-3p	CLIP-seq
MIRT2167526	hsa-miR-3128	CLIP-seq
MIRT1926542	hsa-miR-3138	CLIP-seq
MIRT2167527	hsa-miR-3144-5p	CLIP-seq
MIRT2167528	hsa-miR-3150b-3p	CLIP-seq
MIRT768080	hsa-miR-3153	CLIP-seq
MIRT2167529	hsa-miR-3155	CLIP-seq
MIRT2167530	hsa-miR-3155b	CLIP-seq
MIRT2167531	hsa-miR-3160-3p	CLIP-seq
MIRT2167532	hsa-miR-3191	CLIP-seq
MIRT2167533	hsa-miR-3201	CLIP-seq
MIRT1926546	hsa-miR-320e	CLIP-seq
MIRT2167534	hsa-miR-324-3p	CLIP-seq
MIRT2167535	hsa-miR-342-5p	CLIP-seq
MIRT2167536	hsa-miR-3609	CLIP-seq
MIRT768085	hsa-miR-361-3p	CLIP-seq
MIRT1926547	hsa-miR-3616-3p	CLIP-seq
MIRT2167537	hsa-miR-3652	CLIP-seq
MIRT2167538	hsa-miR-371b-3p	CLIP-seq
MIRT2167539	hsa-miR-376c	CLIP-seq
MIRT1926550	hsa-miR-3911	CLIP-seq
MIRT1926551	hsa-miR-3916	CLIP-seq
MIRT768087	hsa-miR-3921	CLIP-seq
MIRT768057	hsa-miR-4253	CLIP-seq
MIRT2167540	hsa-miR-4254	CLIP-seq
MIRT1926552	hsa-miR-4257	CLIP-seq
MIRT2167541	hsa-miR-4266	CLIP-seq
MIRT1926554	hsa-miR-4267	CLIP-seq
MIRT1926555	hsa-miR-4270	CLIP-seq
MIRT768092	hsa-miR-4271	CLIP-seq
MIRT2167542	hsa-miR-4283	CLIP-seq
MIRT2167543	hsa-miR-4290	CLIP-seq
MIRT2167544	hsa-miR-4292	CLIP-seq
MIRT768094	hsa-miR-4303	CLIP-seq
MIRT2167545	hsa-miR-4306	CLIP-seq
MIRT2167546	hsa-miR-4308	CLIP-seq
MIRT1926556	hsa-miR-4313	CLIP-seq
MIRT768059	hsa-miR-4316	CLIP-seq
MIRT1926557	hsa-miR-4318	CLIP-seq
MIRT2167547	hsa-miR-4323	CLIP-seq
MIRT2167548	hsa-miR-4430	CLIP-seq
MIRT1926558	hsa-miR-4436b-3p	CLIP-seq
MIRT1926559	hsa-miR-4441	CLIP-seq
MIRT1926560	hsa-miR-4455	CLIP-seq
MIRT768098	hsa-miR-4457	CLIP-seq
MIRT2167549	hsa-miR-4489	CLIP-seq
MIRT2167550	hsa-miR-4505	CLIP-seq
MIRT1926562	hsa-miR-4520a-3p	CLIP-seq
MIRT1926563	hsa-miR-4536	CLIP-seq
MIRT2167551	hsa-miR-4643	CLIP-seq
MIRT2167552	hsa-miR-4644	CLIP-seq
MIRT2167553	hsa-miR-4651	CLIP-seq
MIRT2167554	hsa-miR-4652-5p	CLIP-seq
MIRT768103	hsa-miR-4653-5p	CLIP-seq
MIRT2167555	hsa-miR-4664-5p	CLIP-seq
MIRT768105	hsa-miR-4667-5p	CLIP-seq
MIRT1926564	hsa-miR-4685-5p	CLIP-seq
MIRT1926565	hsa-miR-4689	CLIP-seq
MIRT2167556	hsa-miR-4695-5p	CLIP-seq
MIRT768106	hsa-miR-4700-5p	CLIP-seq
MIRT1926566	hsa-miR-4708-5p	CLIP-seq
MIRT1926567	hsa-miR-4713-3p	CLIP-seq
MIRT1926568	hsa-miR-4717-3p	CLIP-seq
MIRT2167557	hsa-miR-4722-5p	CLIP-seq
MIRT768107	hsa-miR-4725-3p	CLIP-seq
MIRT2167558	hsa-miR-4731-5p	CLIP-seq
MIRT2167559	hsa-miR-4779	CLIP-seq
MIRT2167560	hsa-miR-4784	CLIP-seq
MIRT2167561	hsa-miR-4791	CLIP-seq
MIRT1926570	hsa-miR-4800-5p	CLIP-seq
MIRT768109	hsa-miR-4802-3p	CLIP-seq
MIRT2167562	hsa-miR-484	CLIP-seq
MIRT768065	hsa-miR-490-3p	CLIP-seq
MIRT768066	hsa-miR-5096	CLIP-seq
MIRT768067	hsa-miR-513a-5p	CLIP-seq
MIRT2167563	hsa-miR-520g	CLIP-seq
MIRT2167564	hsa-miR-520h	CLIP-seq
MIRT768068	hsa-miR-532-3p	CLIP-seq
MIRT1926573	hsa-miR-542-5p	CLIP-seq
MIRT2167565	hsa-miR-548ah	CLIP-seq
MIRT2167566	hsa-miR-608	CLIP-seq
MIRT2167567	hsa-miR-670	CLIP-seq
MIRT2167568	hsa-miR-873	CLIP-seq
MIRT768098	hsa-miR-4457	CLIP-seq
MIRT2167557	hsa-miR-4722-5p	CLIP-seq
MIRT2167523	hsa-miR-31	CLIP-seq
MIRT1926533	hsa-miR-1271	CLIP-seq
MIRT1926536	hsa-miR-182	CLIP-seq
MIRT1926540	hsa-miR-3125	CLIP-seq
MIRT1926551	hsa-miR-3916	CLIP-seq
MIRT2441918	hsa-miR-4725-5p	CLIP-seq
MIRT2441919	hsa-miR-504	CLIP-seq
MIRT1926577	hsa-miR-96	CLIP-seq
MIRT2443237	hsa-miR-1321	CLIP-seq
MIRT2443238	hsa-miR-4699-5p	CLIP-seq
MIRT2443239	hsa-miR-4739	CLIP-seq
MIRT2443240	hsa-miR-4756-5p	CLIP-seq
MIRT768037	hsa-miR-1224-3p	CLIP-seq
MIRT2470100	hsa-miR-1231	CLIP-seq
MIRT2470101	hsa-miR-1236	CLIP-seq
MIRT768038	hsa-miR-1260	CLIP-seq
MIRT768039	hsa-miR-1260b	CLIP-seq
MIRT768073	hsa-miR-1264	CLIP-seq
MIRT2470102	hsa-miR-1270	CLIP-seq
MIRT1926533	hsa-miR-1271	CLIP-seq
MIRT768041	hsa-miR-1280	CLIP-seq
MIRT2470103	hsa-miR-1299	CLIP-seq
MIRT768043	hsa-miR-1324	CLIP-seq
MIRT2167518	hsa-miR-135a	CLIP-seq
MIRT2167519	hsa-miR-135b	CLIP-seq
MIRT2470104	hsa-miR-150	CLIP-seq
MIRT1926536	hsa-miR-182	CLIP-seq
MIRT2167520	hsa-miR-185	CLIP-seq
MIRT2470105	hsa-miR-188-3p	CLIP-seq
MIRT2470106	hsa-miR-188-5p	CLIP-seq
MIRT2470107	hsa-miR-224	CLIP-seq
MIRT1926539	hsa-miR-3064-3p	CLIP-seq
MIRT2167523	hsa-miR-31	CLIP-seq
MIRT2470108	hsa-miR-3120-5p	CLIP-seq
MIRT1926540	hsa-miR-3125	CLIP-seq
MIRT2167526	hsa-miR-3128	CLIP-seq
MIRT1926542	hsa-miR-3138	CLIP-seq
MIRT2470109	hsa-miR-3144-3p	CLIP-seq
MIRT2167527	hsa-miR-3144-5p	CLIP-seq
MIRT768050	hsa-miR-3148	CLIP-seq
MIRT768051	hsa-miR-3156-3p	CLIP-seq
MIRT768052	hsa-miR-3162-3p	CLIP-seq
MIRT2470110	hsa-miR-3162-5p	CLIP-seq
MIRT2167532	hsa-miR-3191	CLIP-seq
MIRT2167533	hsa-miR-3201	CLIP-seq
MIRT768084	hsa-miR-331-3p	CLIP-seq
MIRT2470111	hsa-miR-337-3p	CLIP-seq
MIRT2470112	hsa-miR-3614-5p	CLIP-seq
MIRT2167537	hsa-miR-3652	CLIP-seq
MIRT2470113	hsa-miR-3661	CLIP-seq
MIRT2470114	hsa-miR-3667-3p	CLIP-seq
MIRT2470115	hsa-miR-3684	CLIP-seq
MIRT2167539	hsa-miR-376c	CLIP-seq
MIRT1926550	hsa-miR-3911	CLIP-seq
MIRT1926551	hsa-miR-3916	CLIP-seq
MIRT2470116	hsa-miR-3929	CLIP-seq
MIRT2470117	hsa-miR-3941	CLIP-seq
MIRT1926555	hsa-miR-4270	CLIP-seq
MIRT2167543	hsa-miR-4290	CLIP-seq
MIRT768058	hsa-miR-4301	CLIP-seq
MIRT2167545	hsa-miR-4306	CLIP-seq
MIRT1926556	hsa-miR-4313	CLIP-seq
MIRT1926557	hsa-miR-4318	CLIP-seq
MIRT2470118	hsa-miR-4419b	CLIP-seq
MIRT2167548	hsa-miR-4430	CLIP-seq
MIRT1926559	hsa-miR-4441	CLIP-seq
MIRT1926560	hsa-miR-4455	CLIP-seq
MIRT2470119	hsa-miR-4474-5p	CLIP-seq
MIRT2470120	hsa-miR-4478	CLIP-seq
MIRT2167550	hsa-miR-4505	CLIP-seq
MIRT1926562	hsa-miR-4520a-3p	CLIP-seq
MIRT2470121	hsa-miR-4531	CLIP-seq
MIRT1926563	hsa-miR-4536	CLIP-seq
MIRT2167551	hsa-miR-4643	CLIP-seq
MIRT2167552	hsa-miR-4644	CLIP-seq
MIRT2470122	hsa-miR-4652-3p	CLIP-seq
MIRT2167554	hsa-miR-4652-5p	CLIP-seq
MIRT2470123	hsa-miR-466	CLIP-seq
MIRT768105	hsa-miR-4667-5p	CLIP-seq
MIRT2470124	hsa-miR-4672	CLIP-seq
MIRT1926564	hsa-miR-4685-5p	CLIP-seq
MIRT2443238	hsa-miR-4699-5p	CLIP-seq
MIRT768106	hsa-miR-4700-5p	CLIP-seq
MIRT1926566	hsa-miR-4708-5p	CLIP-seq
MIRT1926567	hsa-miR-4713-3p	CLIP-seq
MIRT2470125	hsa-miR-4714-5p	CLIP-seq
MIRT1926568	hsa-miR-4717-3p	CLIP-seq
MIRT2441918	hsa-miR-4725-5p	CLIP-seq
MIRT2470126	hsa-miR-4731-3p	CLIP-seq
MIRT2167558	hsa-miR-4731-5p	CLIP-seq
MIRT2167561	hsa-miR-4791	CLIP-seq
MIRT1926570	hsa-miR-4800-5p	CLIP-seq
MIRT2470127	hsa-miR-4801	CLIP-seq
MIRT768110	hsa-miR-501-3p	CLIP-seq
MIRT768111	hsa-miR-502-3p	CLIP-seq
MIRT2441919	hsa-miR-504	CLIP-seq
MIRT768068	hsa-miR-532-3p	CLIP-seq
MIRT1926573	hsa-miR-542-5p	CLIP-seq
MIRT768118	hsa-miR-570	CLIP-seq
MIRT2470128	hsa-miR-602	CLIP-seq
MIRT2470129	hsa-miR-619	CLIP-seq
MIRT2470130	hsa-miR-620	CLIP-seq
MIRT2470131	hsa-miR-631	CLIP-seq
MIRT2470132	hsa-miR-7	CLIP-seq
MIRT768121	hsa-miR-875-3p	CLIP-seq
MIRT2470133	hsa-miR-935	CLIP-seq
MIRT1926577	hsa-miR-96	CLIP-seq
MIRT768037	hsa-miR-1224-3p	CLIP-seq
MIRT2470101	hsa-miR-1236	CLIP-seq
MIRT768038	hsa-miR-1260	CLIP-seq
MIRT768039	hsa-miR-1260b	CLIP-seq
MIRT1926533	hsa-miR-1271	CLIP-seq
MIRT768041	hsa-miR-1280	CLIP-seq
MIRT768043	hsa-miR-1324	CLIP-seq
MIRT2167518	hsa-miR-135a	CLIP-seq
MIRT2167519	hsa-miR-135b	CLIP-seq
MIRT1926536	hsa-miR-182	CLIP-seq
MIRT2470105	hsa-miR-188-3p	CLIP-seq
MIRT2470106	hsa-miR-188-5p	CLIP-seq
MIRT2674533	hsa-miR-214	CLIP-seq
MIRT1926539	hsa-miR-3064-3p	CLIP-seq
MIRT2167523	hsa-miR-31	CLIP-seq
MIRT2674534	hsa-miR-3120-3p	CLIP-seq
MIRT1926540	hsa-miR-3125	CLIP-seq
MIRT2167526	hsa-miR-3128	CLIP-seq
MIRT1926542	hsa-miR-3138	CLIP-seq
MIRT2167527	hsa-miR-3144-5p	CLIP-seq
MIRT768050	hsa-miR-3148	CLIP-seq
MIRT768051	hsa-miR-3156-3p	CLIP-seq
MIRT2674535	hsa-miR-3166	CLIP-seq
MIRT2167532	hsa-miR-3191	CLIP-seq
MIRT2167533	hsa-miR-3201	CLIP-seq
MIRT2470111	hsa-miR-337-3p	CLIP-seq
MIRT2674536	hsa-miR-3619-5p	CLIP-seq
MIRT2167537	hsa-miR-3652	CLIP-seq
MIRT2470113	hsa-miR-3661	CLIP-seq
MIRT2470114	hsa-miR-3667-3p	CLIP-seq
MIRT2470115	hsa-miR-3684	CLIP-seq
MIRT2167539	hsa-miR-376c	CLIP-seq
MIRT1926550	hsa-miR-3911	CLIP-seq
MIRT1926551	hsa-miR-3916	CLIP-seq
MIRT2470116	hsa-miR-3929	CLIP-seq
MIRT1926555	hsa-miR-4270	CLIP-seq
MIRT2167543	hsa-miR-4290	CLIP-seq
MIRT2674537	hsa-miR-4291	CLIP-seq
MIRT768058	hsa-miR-4301	CLIP-seq
MIRT1926556	hsa-miR-4313	CLIP-seq
MIRT1926557	hsa-miR-4318	CLIP-seq
MIRT2470118	hsa-miR-4419b	CLIP-seq
MIRT2167548	hsa-miR-4430	CLIP-seq
MIRT1926559	hsa-miR-4441	CLIP-seq
MIRT1926560	hsa-miR-4455	CLIP-seq
MIRT2470119	hsa-miR-4474-5p	CLIP-seq
MIRT2470120	hsa-miR-4478	CLIP-seq
MIRT2167550	hsa-miR-4505	CLIP-seq
MIRT2674538	hsa-miR-451b	CLIP-seq
MIRT1926562	hsa-miR-4520a-3p	CLIP-seq
MIRT1926563	hsa-miR-4536	CLIP-seq
MIRT2167551	hsa-miR-4643	CLIP-seq
MIRT2167554	hsa-miR-4652-5p	CLIP-seq
MIRT768105	hsa-miR-4667-5p	CLIP-seq
MIRT1926564	hsa-miR-4685-5p	CLIP-seq
MIRT768106	hsa-miR-4700-5p	CLIP-seq
MIRT1926566	hsa-miR-4708-5p	CLIP-seq
MIRT1926567	hsa-miR-4713-3p	CLIP-seq
MIRT2470125	hsa-miR-4714-5p	CLIP-seq
MIRT1926568	hsa-miR-4717-3p	CLIP-seq
MIRT2441918	hsa-miR-4725-5p	CLIP-seq
MIRT2167558	hsa-miR-4731-5p	CLIP-seq
MIRT2167561	hsa-miR-4791	CLIP-seq
MIRT1926570	hsa-miR-4800-5p	CLIP-seq
MIRT768110	hsa-miR-501-3p	CLIP-seq
MIRT768111	hsa-miR-502-3p	CLIP-seq
MIRT2441919	hsa-miR-504	CLIP-seq
MIRT768068	hsa-miR-532-3p	CLIP-seq
MIRT1926573	hsa-miR-542-5p	CLIP-seq
MIRT768118	hsa-miR-570	CLIP-seq
MIRT2470129	hsa-miR-619	CLIP-seq
MIRT2470131	hsa-miR-631	CLIP-seq
MIRT2674539	hsa-miR-761	CLIP-seq
MIRT768121	hsa-miR-875-3p	CLIP-seq
MIRT2674540	hsa-miR-922	CLIP-seq
MIRT1926577	hsa-miR-96	CLIP-seq

Gene ontology (GO) Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003091	Process	Renal water homeostasis	ISS
GO:0004016	Function	Adenylate cyclase activity	IBA
GO:0004016	Function	Adenylate cyclase activity	IDA	17916776, 18403039, 23842570
GO:0004016	Function	Adenylate cyclase activity	IEA
GO:0005080	Function	Protein kinase C binding	IDA	17081159
GO:0005515	Function	Protein binding	IPI	17081159
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0006171	Process	CAMP biosynthetic process	IBA
GO:0006171	Process	CAMP biosynthetic process	IDA	17916776, 18403039
GO:0006171	Process	CAMP biosynthetic process	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 17916776
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IDA	18403039
GO:0007192	Process	Adenylate cyclase-activating serotonin receptor signaling pathway	IDA	17110384
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0032420	Component	Stereocilium	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035811	Process	Negative regulation of urine volume	ISS
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	18403039
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0097746	Process	Blood vessel diameter maintenance	IMP	17916776
GO:1904117	Process	Cellular response to vasopressin	ISS
GO:1904322	Process	Cellular response to forskolin	IDA	17916776

Other IDs

• MIM: 600294
• HGNC: 237
• e!Ensembl: ENSG00000174233

Protein

• UniProt ID: O43306
• Protein name: Adenylate cyclase type 6 (EC 4.6.1.1) (ATP pyrophosphate-lyase 6) (Adenylate cyclase type VI) (Adenylyl cyclase 6) (Ca(2+)-inhibitable adenylyl cyclase)
• Protein function: Catalyzes the formation of the signaling molecule cAMP downstream of G protein-coupled receptors (PubMed:17110384, PubMed:17916776). Functions in signaling cascades downstream of beta-adrenergic receptors in the heart and in vascular smooth musc
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00211	Guanylate_cyc	970 → 1164	Adenylate and Guanylate cyclase catalytic domain	Domain
  PF00211	Guanylate_cyc	370 → 553	Adenylate and Guanylate cyclase catalytic domain	Domain
  PF06327	DUF1053	580 → 669	Domain of Unknown Function (DUF1053)	Family
  PF16214	AC_N	11 → 368	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in peripheral blood mononuclear leukocytes (at protein level) (PubMed:17916776). Detected in thyroid (PubMed:10978539). {ECO:0000269|PubMed:10978539}.
• Sequence:

  MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
  PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
  RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
  VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
  CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
  VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
  KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
  LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
  HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
  YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
  QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
  YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC
  GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLT
  PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
  MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
  ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
  LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
  EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
  FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
  YQLECRGVVKVKGKGEMTTYFLNGGPSS

• Sequence length: 1168

Pathways

KEGG Pathway	Reactome Pathway
Purine metabolism	Glucagon signaling in metabolic regulation
Metabolic pathways	PKA activation
Endocrine resistance	PKA activation in glucagon signalling
Rap1 signaling pathway	Adenylate cyclase activating pathway
cGMP-PKG signaling pathway	Adenylate cyclase inhibitory pathway
cAMP signaling pathway	Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Chemokine signaling pathway	Adrenaline,noradrenaline inhibits insulin secretion
Phospholipase D signaling pathway	G alpha (s) signalling events
Hormone signaling	G alpha (z) signalling events
Oocyte meiosis	Vasopressin regulates renal water homeostasis via Aquaporins
Longevity regulating pathway	Hedgehog 'off' state
Longevity regulating pathway - multiple species	ADORA2B mediated anti-inflammatory cytokines production
Adrenergic signaling in cardiomyocytes	FCGR3A-mediated IL10 synthesis
Vascular smooth muscle contraction
Apelin signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Thermogenesis
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Growth hormone synthesis, secretion and action
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Pathways in cancer
Chemical carcinogenesis - receptor activation
Dilated cardiomyopathy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Lethal congenital contracture syndrome 8	Pathogenic	rs786204798, rs1941705738, rs1941551290	RCV000169693 RCV001290106 RCV001290107	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (20)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ADCY6-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DEFORMITY OF CLAVICLE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DEFORMITY OF ELBOW	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DEFORMITY OF FOREARM	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DEFORMITY OF SCAPULA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DEFORMITY OF WRIST	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISLOCATION OF ELBOW	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISLOCATION OF GLENOHUMERAL JOINT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	37196047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LETHAL CONGENITAL CONTRACTURE SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (29)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anemia Sickle Cell	Sickle cell anemia	Pubtator	18324973	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	18324973, 27067484		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	28969474	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	27437887	Associate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	24319099		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis	Pubtator	33820833	Associate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	32108986	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Developmental	Bone disease	Pubtator	33820833	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27437887		★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	22641646		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27810435		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	17007567		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27437887		★☆☆☆☆ Found in Text Mining only
Hypomyelination neuropathy-arthrogryposis syndrome	Hypomyelination Neuropathy-Arthrogryposis Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	14871025		★☆☆☆☆ Found in Text Mining only
LETHAL CONGENITAL CONTRACTURE SYNDROME 8	Lethal Congenital Contracture Syndrome	GENOMICS_ENGLAND_DG	24319099		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LETHAL CONGENITAL CONTRACTURE SYNDROME 8	Lethal Congenital Contracture Syndrome	UNIPROT_DG	24319099		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LETHAL CONGENITAL CONTRACTURE SYNDROME 8	Lethal Congenital Contracture Syndrome	CLINVAR_DG	26257172		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LETHAL CONGENITAL CONTRACTURE SYNDROME 8	Lethal Congenital Contracture Syndrome	BEFREE	31846058		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LETHAL CONGENITAL CONTRACTURE SYNDROME 8	Lethal Congenital Contracture Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metabolic Diseases	Metabolic syndrome	Pubtator	30926763	Associate	★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	28405619		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Dysphagia	Oropharyngeal Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30413613		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	22952279	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	24994926		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33622336	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	12782409		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ZBTB42 8 shared diseasesCongenital deformity of clavicle, Congenital deformity of elbow, Congenital deformity of forearm, Congenital deformity of scapula, Congenital deformity of wrist, Congenital dislocation of elbow, Congenital glenohumeral joint dislocation, Lethal congenital contracture syndrome 12 shared evidence sourcesDisgenet (Congenital deformity of clavicle), Disgenet (Congenital deformity of elbow), Disgenet (Congenital deformity of forearm), Disgenet (Congenital deformity of scapula), Disgenet (Congenital deformity of wrist), Disgenet (Congenital dislocation of elbow), Disgenet (Congenital glenohumeral joint dislocation), Disgenet (Lethal congenital contracture syndrome), CTD (Lethal congenital contracture syndrome), ClinVar (Lethal congenital contracture syndrome), GWAS catalog (Lethal congenital contracture syndrome), HPO (Lethal congenital contracture syndrome) Related via 8 shared diseases including Congenital deformity of clavicle, Congenital deformity of elbow — evidence mostly Disgenet. ADGRG6 8 shared diseasesCongenital deformity of clavicle, Congenital deformity of elbow, Congenital deformity of forearm, Congenital deformity of scapula, Congenital deformity of wrist, Congenital dislocation of elbow, Congenital glenohumeral joint dislocation, Lethal congenital contracture syndrome 12 shared evidence sourcesDisgenet (Congenital deformity of clavicle), Disgenet (Congenital deformity of elbow), Disgenet (Congenital deformity of forearm), Disgenet (Congenital deformity of scapula), Disgenet (Congenital deformity of wrist), Disgenet (Congenital dislocation of elbow), Disgenet (Congenital glenohumeral joint dislocation), Disgenet (Lethal congenital contracture syndrome), CTD (Lethal congenital contracture syndrome), ClinVar (Lethal congenital contracture syndrome), GWAS catalog (Lethal congenital contracture syndrome), HPO (Lethal congenital contracture syndrome) Related via 8 shared diseases including Congenital deformity of clavicle, Congenital deformity of elbow — evidence mostly Disgenet. NEK9 8 shared diseasesCongenital deformity of clavicle, Congenital deformity of elbow, Congenital deformity of forearm, Congenital deformity of scapula, Congenital deformity of wrist, Congenital dislocation of elbow, Congenital glenohumeral joint dislocation, Lethal congenital contracture syndrome 10 shared evidence sourcesDisgenet (Congenital deformity of clavicle), Disgenet (Congenital deformity of elbow), Disgenet (Congenital deformity of forearm), Disgenet (Congenital deformity of scapula), Disgenet (Congenital deformity of wrist), Disgenet (Congenital dislocation of elbow), Disgenet (Congenital glenohumeral joint dislocation), Disgenet (Lethal congenital contracture syndrome), CTD (Lethal congenital contracture syndrome), HPO (Lethal congenital contracture syndrome) Related via 8 shared diseases including Congenital deformity of clavicle, Congenital deformity of elbow — evidence mostly Disgenet. CNTNAP1 8 shared diseasesCongenital deformity of clavicle, Congenital deformity of elbow, Congenital deformity of forearm, Congenital deformity of scapula, Congenital deformity of wrist, Congenital dislocation of elbow, Congenital glenohumeral joint dislocation, Lethal congenital contracture syndrome 11 shared evidence sourcesDisgenet (Congenital deformity of clavicle), Disgenet (Congenital deformity of elbow), Disgenet (Congenital deformity of forearm), Disgenet (Congenital deformity of scapula), Disgenet (Congenital deformity of wrist), Disgenet (Congenital dislocation of elbow), Disgenet (Congenital glenohumeral joint dislocation), Disgenet (Lethal congenital contracture syndrome), CTD (Lethal congenital contracture syndrome), ClinVar (Lethal congenital contracture syndrome), HPO (Lethal congenital contracture syndrome) Related via 8 shared diseases including Congenital deformity of clavicle, Congenital deformity of elbow — evidence mostly Disgenet. GLDN 8 shared diseasesCongenital deformity of clavicle, Congenital deformity of elbow, Congenital deformity of forearm, Congenital deformity of scapula, Congenital deformity of wrist, Congenital dislocation of elbow, Congenital glenohumeral joint dislocation, Lethal congenital contracture syndrome 11 shared evidence sourcesDisgenet (Congenital deformity of clavicle), Disgenet (Congenital deformity of elbow), Disgenet (Congenital deformity of forearm), Disgenet (Congenital deformity of scapula), Disgenet (Congenital deformity of wrist), Disgenet (Congenital dislocation of elbow), Disgenet (Congenital glenohumeral joint dislocation), Disgenet (Lethal congenital contracture syndrome), CTD (Lethal congenital contracture syndrome), ClinVar (Lethal congenital contracture syndrome), HPO (Lethal congenital contracture syndrome) Related via 8 shared diseases including Congenital deformity of clavicle, Congenital deformity of elbow — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ZBTB42	8	["Congenital deformity of clavicle","Congenital deformity of elbow","Congenital deformity of forearm","Congenital deformity of scapula","Congenital deformity of wrist","Congenital dislocation of elbow","Congenital glenohumeral joint dislocation","Lethal congenital contracture syndrome"]	0	[]	12	["Disgenet (Congenital deformity of clavicle)","Disgenet (Congenital deformity of elbow)","Disgenet (Congenital deformity of forearm)","Disgenet (Congenital deformity of scapula)","Disgenet (Congenital deformity of wrist)","Disgenet (Congenital dislocation of elbow)","Disgenet (Congenital glenohumeral joint dislocation)","Disgenet (Lethal congenital contracture syndrome)","CTD (Lethal congenital contracture syndrome)","ClinVar (Lethal congenital contracture syndrome)","GWAS catalog (Lethal congenital contracture syndrome)","HPO (Lethal congenital contracture syndrome)"]
ADGRG6	8	["Congenital deformity of clavicle","Congenital deformity of elbow","Congenital deformity of forearm","Congenital deformity of scapula","Congenital deformity of wrist","Congenital dislocation of elbow","Congenital glenohumeral joint dislocation","Lethal congenital contracture syndrome"]	0	[]	12	["Disgenet (Congenital deformity of clavicle)","Disgenet (Congenital deformity of elbow)","Disgenet (Congenital deformity of forearm)","Disgenet (Congenital deformity of scapula)","Disgenet (Congenital deformity of wrist)","Disgenet (Congenital dislocation of elbow)","Disgenet (Congenital glenohumeral joint dislocation)","Disgenet (Lethal congenital contracture syndrome)","CTD (Lethal congenital contracture syndrome)","ClinVar (Lethal congenital contracture syndrome)","GWAS catalog (Lethal congenital contracture syndrome)","HPO (Lethal congenital contracture syndrome)"]
NEK9	8	["Congenital deformity of clavicle","Congenital deformity of elbow","Congenital deformity of forearm","Congenital deformity of scapula","Congenital deformity of wrist","Congenital dislocation of elbow","Congenital glenohumeral joint dislocation","Lethal congenital contracture syndrome"]	0	[]	10	["Disgenet (Congenital deformity of clavicle)","Disgenet (Congenital deformity of elbow)","Disgenet (Congenital deformity of forearm)","Disgenet (Congenital deformity of scapula)","Disgenet (Congenital deformity of wrist)","Disgenet (Congenital dislocation of elbow)","Disgenet (Congenital glenohumeral joint dislocation)","Disgenet (Lethal congenital contracture syndrome)","CTD (Lethal congenital contracture syndrome)","HPO (Lethal congenital contracture syndrome)"]
CNTNAP1	8	["Congenital deformity of clavicle","Congenital deformity of elbow","Congenital deformity of forearm","Congenital deformity of scapula","Congenital deformity of wrist","Congenital dislocation of elbow","Congenital glenohumeral joint dislocation","Lethal congenital contracture syndrome"]	0	[]	11	["Disgenet (Congenital deformity of clavicle)","Disgenet (Congenital deformity of elbow)","Disgenet (Congenital deformity of forearm)","Disgenet (Congenital deformity of scapula)","Disgenet (Congenital deformity of wrist)","Disgenet (Congenital dislocation of elbow)","Disgenet (Congenital glenohumeral joint dislocation)","Disgenet (Lethal congenital contracture syndrome)","CTD (Lethal congenital contracture syndrome)","ClinVar (Lethal congenital contracture syndrome)","HPO (Lethal congenital contracture syndrome)"]
GLDN	8	["Congenital deformity of clavicle","Congenital deformity of elbow","Congenital deformity of forearm","Congenital deformity of scapula","Congenital deformity of wrist","Congenital dislocation of elbow","Congenital glenohumeral joint dislocation","Lethal congenital contracture syndrome"]	0	[]	11	["Disgenet (Congenital deformity of clavicle)","Disgenet (Congenital deformity of elbow)","Disgenet (Congenital deformity of forearm)","Disgenet (Congenital deformity of scapula)","Disgenet (Congenital deformity of wrist)","Disgenet (Congenital dislocation of elbow)","Disgenet (Congenital glenohumeral joint dislocation)","Disgenet (Lethal congenital contracture syndrome)","CTD (Lethal congenital contracture syndrome)","ClinVar (Lethal congenital contracture syndrome)","HPO (Lethal congenital contracture syndrome)"]

Diseases Linked via Similar Genes

Arthrogryposis multiplex congenita Linked via 3 of 5 related genesADGRG6, CNTNAP1, GLDN Obstructive pulmonary disease Linked via 2 of 5 related genesZBTB42, ADGRG6 Diabetes mellitus type 2 Linked via 2 of 5 related genesZBTB42, ADGRG6 Major depressive disorder Linked via 2 of 5 related genesADGRG6, CNTNAP1 Congenital joint contractures Linked via 2 of 5 related genesNEK9, GLDN

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Arthrogryposis multiplex congenita	3	["ADGRG6","CNTNAP1","GLDN"]
Obstructive pulmonary disease	2	["ZBTB42","ADGRG6"]
Diabetes mellitus type 2	2	["ZBTB42","ADGRG6"]
Major depressive disorder	2	["ADGRG6","CNTNAP1"]
Congenital joint contractures	2	["NEK9","GLDN"]