ACSM5 (acyl-CoA synthetase medium chain family member 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 54988
Gene name Acyl-CoA synthetase medium chain family member 5
Gene symbol ACSM5
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p12.3
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1925078 hsa-miR-3144-5p CLIP-seq
MIRT1925079 hsa-miR-3191 CLIP-seq
MIRT1925080 hsa-miR-4652-5p CLIP-seq
MIRT2383836 hsa-miR-1245 CLIP-seq
MIRT2383837 hsa-miR-1343 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004321 Function Fatty-acyl-CoA synthase activity IBA
GO:0005524 Function ATP binding IEA
GO:0005525 Function GTP binding IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614361 26060 ENSG00000183549
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NUN0
Protein name Acyl-coenzyme A synthetase ACSM5, mitochondrial (EC 6.2.1.2) (Acyl-CoA synthetase medium-chain family member 5)
Protein function Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00501 AMP-binding 66 → 478 AMP-binding enzyme Family
PF13193 AMP-binding_C 486 → 566 AMP-binding enzyme C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in kidney and liver. {ECO:0000269|PubMed:12654705}.
Sequence 
MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVL
DVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMML
VLPRLPEWWLVSVACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAIS
AECPSLQTKLLVSDSSRPGWLNFRELLREASTEHNCMRTKSRDPLAIYFTSGTTGAPKMV
EHSQSSYGLGFVASGRRWVALTESDIFWNTTDTGWVKAAWTLFSAWPNGSCIFVHELPRV
DAKVILNTLSKFPITTLCCVPTIFRLLVQEDLTRYQFQSLRHCLTGGEALNPDVREKWKH
QTGVELYEGYGQSETVVICANPKGMKIKSGSMGKASPPYDVQIVDDEGNVLPPGEEGNVA
VRIRPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSY
RIGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHV
KRVTAPYKYPRKVAFVSELPKTVSGKIQRSKLRSQEWGK
Sequence length 579
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Butanoate metabolism Conjugation of salicylate with glycine
Metabolic pathways  
Sort by:
ACSM2A 2 shared pathwaysButanoate metabolism, Conjugation of salicylate with glycine Related via 2 shared pathways including Butanoate metabolism, Conjugation of salicylate with glycine. ACSM4 2 shared pathwaysButanoate metabolism, Conjugation of salicylate with glycine Related via 2 shared pathways including Butanoate metabolism, Conjugation of salicylate with glycine. ACSM2B 2 shared pathwaysButanoate metabolism, Conjugation of salicylate with glycine Related via 2 shared pathways including Butanoate metabolism, Conjugation of salicylate with glycine.
Astrocytoma Linked via 2 of 3 related genesACSM2A, ACSM2B Central nervous system cancer Linked via 2 of 3 related genesACSM2A, ACSM2B Glioma Linked via 2 of 3 related genesACSM2A, ACSM2B Gout Linked via 2 of 3 related genesACSM2A, ACSM2B Hyperpituitarism Linked via 1 of 3 related genesACSM2A