ACOX3 (acyl-CoA oxidase 3, pristanoyl)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8310
• Gene name: Acyl-CoA oxidase 3, pristanoyl
• Gene symbol: ACOX3
• Synonyms (NCBI Gene): -
• Chromosome: 4
• Chromosome location: 4p16.1
• Summary: Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was

miRNA Show/Hide all (81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT763147	hsa-miR-15a	CLIP-seq
MIRT763148	hsa-miR-15b	CLIP-seq
MIRT763149	hsa-miR-16	CLIP-seq
MIRT763150	hsa-miR-195	CLIP-seq
MIRT763151	hsa-miR-24	CLIP-seq
MIRT763152	hsa-miR-424	CLIP-seq
MIRT763153	hsa-miR-4437	CLIP-seq
MIRT763154	hsa-miR-497	CLIP-seq
MIRT2166138	hsa-miR-1245b-3p	CLIP-seq
MIRT2166139	hsa-miR-1247	CLIP-seq
MIRT2166140	hsa-miR-1285	CLIP-seq
MIRT2166141	hsa-miR-1299	CLIP-seq
MIRT2166142	hsa-miR-1304	CLIP-seq
MIRT2166143	hsa-miR-1470	CLIP-seq
MIRT2166144	hsa-miR-154	CLIP-seq
MIRT763147	hsa-miR-15a	CLIP-seq
MIRT763148	hsa-miR-15b	CLIP-seq
MIRT763149	hsa-miR-16	CLIP-seq
MIRT2166145	hsa-miR-181a	CLIP-seq
MIRT2166146	hsa-miR-181b	CLIP-seq
MIRT2166147	hsa-miR-181c	CLIP-seq
MIRT2166148	hsa-miR-181d	CLIP-seq
MIRT763150	hsa-miR-195	CLIP-seq
MIRT2166149	hsa-miR-19a	CLIP-seq
MIRT2166150	hsa-miR-19b	CLIP-seq
MIRT2166151	hsa-miR-204	CLIP-seq
MIRT2166152	hsa-miR-211	CLIP-seq
MIRT2166153	hsa-miR-214	CLIP-seq
MIRT763151	hsa-miR-24	CLIP-seq
MIRT2166154	hsa-miR-3187-5p	CLIP-seq
MIRT2166155	hsa-miR-3529	CLIP-seq
MIRT2166156	hsa-miR-3619-5p	CLIP-seq
MIRT2166157	hsa-miR-379	CLIP-seq
MIRT2166158	hsa-miR-3920	CLIP-seq
MIRT2166159	hsa-miR-3927	CLIP-seq
MIRT2166160	hsa-miR-3942-3p	CLIP-seq
MIRT763152	hsa-miR-424	CLIP-seq
MIRT2166161	hsa-miR-425	CLIP-seq
MIRT2166162	hsa-miR-4262	CLIP-seq
MIRT2166163	hsa-miR-4291	CLIP-seq
MIRT763153	hsa-miR-4437	CLIP-seq
MIRT2166164	hsa-miR-4466	CLIP-seq
MIRT2166165	hsa-miR-4469	CLIP-seq
MIRT2166166	hsa-miR-455-5p	CLIP-seq
MIRT2166167	hsa-miR-4667-3p	CLIP-seq
MIRT2166168	hsa-miR-4711-5p	CLIP-seq
MIRT2166169	hsa-miR-4755-5p	CLIP-seq
MIRT2166170	hsa-miR-4767	CLIP-seq
MIRT2166171	hsa-miR-4782-5p	CLIP-seq
MIRT763154	hsa-miR-497	CLIP-seq
MIRT2166172	hsa-miR-516b	CLIP-seq
MIRT2166173	hsa-miR-552	CLIP-seq
MIRT2166174	hsa-miR-612	CLIP-seq
MIRT2166175	hsa-miR-623	CLIP-seq
MIRT2166176	hsa-miR-661	CLIP-seq
MIRT2166177	hsa-miR-675	CLIP-seq
MIRT2166178	hsa-miR-761	CLIP-seq
MIRT2166179	hsa-miR-764	CLIP-seq
MIRT2166180	hsa-miR-875-3p	CLIP-seq
MIRT2166181	hsa-miR-922	CLIP-seq
MIRT2166144	hsa-miR-154	CLIP-seq
MIRT2166161	hsa-miR-425	CLIP-seq
MIRT2468759	hsa-miR-1303	CLIP-seq
MIRT2468760	hsa-miR-1587	CLIP-seq
MIRT2468761	hsa-miR-28-5p	CLIP-seq
MIRT2468762	hsa-miR-3123	CLIP-seq
MIRT2468763	hsa-miR-3139	CLIP-seq
MIRT2468764	hsa-miR-3160-3p	CLIP-seq
MIRT2468765	hsa-miR-3925-5p	CLIP-seq
MIRT2468766	hsa-miR-4492	CLIP-seq
MIRT2468767	hsa-miR-4498	CLIP-seq
MIRT2468768	hsa-miR-4656	CLIP-seq
MIRT2468769	hsa-miR-4675	CLIP-seq
MIRT2468770	hsa-miR-4687-3p	CLIP-seq
MIRT2468771	hsa-miR-4741	CLIP-seq
MIRT2468772	hsa-miR-548a-3p	CLIP-seq
MIRT2468773	hsa-miR-548e	CLIP-seq
MIRT2468774	hsa-miR-548f	CLIP-seq
MIRT2468775	hsa-miR-570	CLIP-seq
MIRT2468776	hsa-miR-708	CLIP-seq
MIRT2468777	hsa-miR-762	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003997	Function	Acyl-CoA oxidase activity	IEA
GO:0005504	Function	Fatty acid binding	IBA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	8993592
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016402	Function	Pristanoyl-CoA oxidase activity	IBA
GO:0016402	Function	Pristanoyl-CoA oxidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016627	Function	Oxidoreductase activity, acting on the CH-CH group of donors	IEA
GO:0033540	Process	Fatty acid beta-oxidation using acyl-CoA oxidase	IBA
GO:0033540	Process	Fatty acid beta-oxidation using acyl-CoA oxidase	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0071949	Function	FAD binding	IEA

Other IDs

• MIM: 603402
• HGNC: 121
• e!Ensembl: ENSG00000087008

Protein

• UniProt ID: O15254
• Protein name: Peroxisomal acyl-coenzyme A oxidase 3 (EC 1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox) (Pristanoyl-CoA oxidase)
• Protein function: Oxidizes the CoA-esters of 2-methyl-branched fatty acids.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01756	ACOX	510 → 693	Acyl-CoA oxidase	Family
  PF02770	Acyl-CoA_dh_M	155 → 266	Acyl-CoA dehydrogenase, middle domain	Domain

• Sequence:

  MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPL
  FARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAK
  YLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPAT
  EEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMP
  GVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGAS
  LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYL
  AAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQ
  ECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFR
  SPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSG
  SSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSL
  SRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADG
  ELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL

• Sequence length: 700

Pathways

KEGG Pathway	Reactome Pathway
Fatty acid degradation	Beta-oxidation of pristanoyl-CoA
beta-Alanine metabolism	Peroxisomal protein import
alpha-Linolenic acid metabolism
Propanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
cAMP signaling pathway
Peroxisome
Alcoholic liver disease

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (20)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	34594039, 35332129	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	35335125	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34970420	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15599942		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15599942		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15599942		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SPC24 2 shared diseasesCarpal tunnel syndrome, Hemorrhoid 2 shared evidence sourcesGWAS catalog (Carpal tunnel syndrome), GWAS catalog (Hemorrhoid) Related via 2 shared diseases including Carpal tunnel syndrome, Hemorrhoid — evidence mostly GWAS catalog. ACOX1 12 shared pathwaysFatty acid degradation, beta-Alanine metabolism, alpha-Linolenic acid metabolism, Propanoate metabolism, Biosynthesis of unsaturated fatty acids, Carbon metabolism, Fatty acid metabolism, PPAR signaling pathway, cAMP signaling pathway, Peroxisome, Alcoholic liver disease, Peroxisomal protein import Related via 12 shared pathways including Fatty acid degradation, beta-Alanine metabolism. ACAA1 7 shared pathwaysFatty acid degradation, alpha-Linolenic acid metabolism, Biosynthesis of unsaturated fatty acids, Fatty acid metabolism, PPAR signaling pathway, Peroxisome, Peroxisomal protein import Related via 7 shared pathways including Fatty acid degradation, alpha-Linolenic acid metabolism. EHHADH 7 shared pathwaysFatty acid degradation, beta-Alanine metabolism, Propanoate metabolism, Fatty acid metabolism, PPAR signaling pathway, Peroxisome, Peroxisomal protein import Related via 7 shared pathways including Fatty acid degradation, beta-Alanine metabolism. SCP2 6 shared pathwaysBiosynthesis of unsaturated fatty acids, Fatty acid metabolism, PPAR signaling pathway, Peroxisome, Beta-oxidation of pristanoyl-CoA, Peroxisomal protein import Related via 6 shared pathways including Biosynthesis of unsaturated fatty acids, Fatty acid metabolism.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SPC24	2	["Carpal tunnel syndrome","Hemorrhoid"]	0	[]	2	["GWAS catalog (Carpal tunnel syndrome)","GWAS catalog (Hemorrhoid)"]
ACOX1	0	[]	12	["Fatty acid degradation","beta-Alanine metabolism","alpha-Linolenic acid metabolism","Propanoate metabolism","Biosynthesis of unsaturated fatty acids","Carbon metabolism","Fatty acid metabolism","PPAR signaling pathway","cAMP signaling pathway","Peroxisome","Alcoholic liver disease","Peroxisomal protein import"]	0	[]
ACAA1	0	[]	7	["Fatty acid degradation","alpha-Linolenic acid metabolism","Biosynthesis of unsaturated fatty acids","Fatty acid metabolism","PPAR signaling pathway","Peroxisome","Peroxisomal protein import"]	0	[]
EHHADH	0	[]	7	["Fatty acid degradation","beta-Alanine metabolism","Propanoate metabolism","Fatty acid metabolism","PPAR signaling pathway","Peroxisome","Peroxisomal protein import"]	0	[]
SCP2	0	[]	6	["Biosynthesis of unsaturated fatty acids","Fatty acid metabolism","PPAR signaling pathway","Peroxisome","Beta-oxidation of pristanoyl-CoA","Peroxisomal protein import"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesACOX1, EHHADH Central nervous system cancer Linked via 1 of 5 related genesSPC24 Coronary artery disease Linked via 1 of 5 related genesSPC24 Glioblastoma Linked via 1 of 5 related genesSPC24 Glioma Linked via 1 of 5 related genesSPC24

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["ACOX1","EHHADH"]
Central nervous system cancer	1	["SPC24"]
Coronary artery disease	1	["SPC24"]
Glioblastoma	1	["SPC24"]
Glioma	1	["SPC24"]