Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5030
Gene name	Pyrimidinergic receptor P2Y4
Gene symbol	P2RY4
Synonyms (NCBI Gene)	NRUP2PP2Y4UNR
Chromosome	X
Chromosome location	Xq13.1
Summary	The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT2060055	hsa-miR-3194-3p	CLIP-seq
MIRT2060056	hsa-miR-3663-5p	CLIP-seq
MIRT2060057	hsa-miR-4527	CLIP-seq
MIRT2288407	hsa-miR-1254	CLIP-seq
MIRT2288408	hsa-miR-3116	CLIP-seq
MIRT2288409	hsa-miR-3925-3p	CLIP-seq
MIRT737790	hsa-miR-4768-5p	CLIP-seq
MIRT2288410	hsa-miR-520a-5p	CLIP-seq
MIRT2288411	hsa-miR-525-5p	CLIP-seq
MIRT2288412	hsa-miR-766	CLIP-seq
MIRT2288413	hsa-miR-942	CLIP-seq

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8537336
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8537336
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	8537335
GO:0016020	Component	Membrane	IEA
GO:0030321	Process	Transepithelial chloride transport	IEA
GO:0030321	Process	Transepithelial chloride transport	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IEA
GO:0045030	Function	G protein-coupled UTP receptor activity	IBA
GO:0045030	Function	G protein-coupled UTP receptor activity	IEA
GO:0045030	Function	G protein-coupled UTP receptor activity	TAS	8537335
GO:0071318	Process	Cellular response to ATP	TAS	12151016
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA

MIM	HGNC	e!Ensembl
300038	8542	ENSG00000186912

P51582

Protein name

P2Y purinoceptor 4 (P2Y4) (P2P) (Uridine nucleotide receptor) (UNR)

Protein function

Receptor for UTP and UDP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. Not activated by ATP or ADP.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	52 → 306	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Pancreas.

Sequence

MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
RADRL

Sequence length

365

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	P2Y receptors
Taste transduction	G alpha (i) signalling events

P2RY4 (pyrimidinergic receptor P2Y4)

Bookmark This Gene