Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	474382
Gene name	H2A.B variant histone 1
Gene symbol	H2AB1
Synonyms (NCBI Gene)	H2A.BH2A.B.2H2A.BbdH2AFB1
Chromosome	X
Chromosome location	Xq28
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IBA
GO:0000786	Component	Nucleosome	IDA	22795134
GO:0000786	Component	Nucleosome	IEA
GO:0000791	Component	Euchromatin	IDA	22795134
GO:0000791	Component	Euchromatin	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006334	Process	Nucleosome assembly	IDA	22795134
GO:0006334	Process	Nucleosome assembly	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	IMP	22795134
GO:0030527	Function	Structural constituent of chromatin	IBA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031507	Process	Heterochromatin formation	IBA
GO:0046982	Function	Protein heterodimerization activity	IEA

MIM	HGNC	e!Ensembl
301037	22516	ENSG00000274183

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	P0C5Y9
Protein name	Histone H2A-Bbd type 1 (H2A Barr body-deficient) (H2A.B) (H2A.Bbd)
Protein function	Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing (PubMed:22795134). Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cel
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Present in mature sperm. {ECO:0000269\|PubMed:20008104}.
Sequence	MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI EYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
Sequence length	115
Interactions	View interactions

KEGG Pathway	Reactome Pathway
ATP-dependent chromatin remodeling	Recognition and association of DNA glycosylase with site containing an affected purine
Necroptosis	Cleavage of the damaged purine
Neutrophil extracellular trap formation	Packaging Of Telomere Ends
Alcoholism	Formation of the beta-catenin:TCF transactivating complex
Systemic lupus erythematosus	PRC2 methylates histones and DNA
	Condensation of Prophase Chromosomes
	Oxidative Stress Induced Senescence
	Senescence-Associated Secretory Phenotype (SASP)
	DNA Damage/Telomere Stress Induced Senescence
	RMTs methylate histone arginines
	SIRT1 negatively regulates rRNA expression
	NoRC negatively regulates rRNA expression
	B-WICH complex positively regulates rRNA expression
	Transcriptional regulation by small RNAs
	Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
	Deposition of new CENPA-containing nucleosomes at the centromere
	RNA Polymerase I Promoter Opening
	RNA Polymerase I Promoter Escape
	RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
	Estrogen-dependent gene expression
	Amyloid fiber formation

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
H2AZ1	[]	26	["ATP-dependent chromatin remodeling","Necroptosis","Neutrophil extracellular trap formation","Alcoholism","Systemic lupus erythematosus","Condensation of Prophase Chromosomes","Deposition of new CENPA-containing nucleosomes at the centromere","Oxidative Stress Induced Senescence","Amyloid fiber formation","DNA Damage\/Telomere Stress Induced Senescence","Senescence-Associated Secretory Phenotype (SASP)","RMTs methylate histone arginines"]	[]
H2AJ	[]	25	["ATP-dependent chromatin remodeling","Necroptosis","Neutrophil extracellular trap formation","Alcoholism","Systemic lupus erythematosus","Condensation of Prophase Chromosomes","Deposition of new CENPA-containing nucleosomes at the centromere","Oxidative Stress Induced Senescence","DNA Damage\/Telomere Stress Induced Senescence","Senescence-Associated Secretory Phenotype (SASP)","RMTs methylate histone arginines","RNA Polymerase I Promoter Escape"]	[]
H2AZ2	[]	25	["ATP-dependent chromatin remodeling","Necroptosis","Neutrophil extracellular trap formation","Alcoholism","Systemic lupus erythematosus","Condensation of Prophase Chromosomes","Deposition of new CENPA-containing nucleosomes at the centromere","Oxidative Stress Induced Senescence","DNA Damage\/Telomere Stress Induced Senescence","Senescence-Associated Secretory Phenotype (SASP)","RMTs methylate histone arginines","RNA Polymerase I Promoter Escape"]	[]
H2AX	[]	26	["ATP-dependent chromatin remodeling","Necroptosis","Neutrophil extracellular trap formation","Alcoholism","Systemic lupus erythematosus","Condensation of Prophase Chromosomes","Deposition of new CENPA-containing nucleosomes at the centromere","Oxidative Stress Induced Senescence","Amyloid fiber formation","DNA Damage\/Telomere Stress Induced Senescence","Senescence-Associated Secretory Phenotype (SASP)","RMTs methylate histone arginines"]	[]
H2AC8	[]	26	["ATP-dependent chromatin remodeling","Necroptosis","Neutrophil extracellular trap formation","Alcoholism","Systemic lupus erythematosus","Condensation of Prophase Chromosomes","Deposition of new CENPA-containing nucleosomes at the centromere","Oxidative Stress Induced Senescence","Amyloid fiber formation","DNA Damage\/Telomere Stress Induced Senescence","Senescence-Associated Secretory Phenotype (SASP)","RMTs methylate histone arginines"]	[]

H2AB1 (H2A.B variant histone 1)

Bookmark This Gene