ZSWIM2 (zinc finger SWIM-type containing 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 151112
• Gene name: Zinc finger SWIM-type containing 2
• Gene symbol: ZSWIM2
• Synonyms (NCBI Gene): MEX, ZZZ2
• Chromosome: 2
• Chromosome location: 2q32.1

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1543952	hsa-miR-142-3p	CLIP-seq
MIRT1543953	hsa-miR-4280	CLIP-seq
MIRT1543954	hsa-miR-595	CLIP-seq
MIRT1543952	hsa-miR-142-3p	CLIP-seq
MIRT2164169	hsa-miR-3174	CLIP-seq
MIRT2164170	hsa-miR-3671	CLIP-seq
MIRT2164171	hsa-miR-3942-3p	CLIP-seq
MIRT1543953	hsa-miR-4280	CLIP-seq
MIRT1543954	hsa-miR-595	CLIP-seq
MIRT2164172	hsa-miR-607	CLIP-seq
MIRT2164173	hsa-miR-921	CLIP-seq
MIRT2383292	hsa-miR-155	CLIP-seq
MIRT2383293	hsa-miR-224	CLIP-seq
MIRT2383294	hsa-miR-4718	CLIP-seq
MIRT2696449	hsa-miR-3140-5p	CLIP-seq
MIRT2696450	hsa-miR-433	CLIP-seq
MIRT2696451	hsa-miR-4427	CLIP-seq
MIRT2696452	hsa-miR-4793-5p	CLIP-seq
MIRT2696453	hsa-miR-664	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8NEG5
• Protein name: E3 ubiquitin-protein ligase ZSWIM2 (EC 2.3.2.27) (MEKK1-related protein X) (MEX) (RING-type E3 ubiquitin transferase ZSWIM2) (ZZ-type zinc finger-containing protein 2) (Zinc finger SWIM domain-containing protein 2)
• Protein function: E3 ubiquitin-protein ligase involved in the regulation of Fas-, DR3- and DR4-mediated apoptosis. Functions in conjunction with the UBE2D1, UBE2D3 and UBE2E1 E2 ubiquitin-conjugating enzymes.
• PDB: 2DIP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00569	ZZ	228 → 273	Zinc finger, ZZ type	Domain
  PF04434	SWIM	54 → 87	SWIM zinc finger	Domain
  PF13639	zf-RING_2	342 → 385	Ring finger domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expression is testis-specific. {ECO:0000269|PubMed:35831855}.
• Sequence:

  MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGN
  PHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQLGLGEREISDLLRGIHRVQTPQ
  PGTNDENEHVEEDGYIKQKEIDSEDICSICQELLLEKKLPVTFCRFGCGNSIHIKCMKIL
  ANYQSTSNTSMLKCPLCRKEFAPLKLILEEFKNSSKLVAAAEKERLDKHLGIPCNNCKQF
  PIEGKCYKCTECIEYHLCQECFDSCCHLSHTFTFREKRNQKWRSLEKRADEVVKYIDTKN
  EIEEKMSHFQEKQGQVYTPKHIVRSLPLQLITKNSKLLAPGYQCLLCLKAFHLGQHTRLL
  PCTHKFHRKCIDNWLFHKCNSCPIDGQVIYNPLTWKNSAVNGQAHQSVSNRDIIHLSKQK
  EPDLFIPGTGLVLKQNRLGILPSIPQCNFDELNTPQSPKDAYENTTIDNLCSIKLDNSNS
  KKLTYDYKISQHFPRYLQDLPTVSFGKIPSQTLLPPIVHKNIVCPTAMESPCISGKFHTS
  LSRMTKGCKCNNHNLKKTPATKIREDNKRSTLLPEDFNLIVNWSTAKLSLSKRYSNCMGE
  ITRKCSHLSRQPVSHSVNTKSTELSLIIEGVQL

• Sequence length: 633

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Kidney Diseases	Kidney Disease	BEFREE	19399503		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19399503		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19399503		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for ZSWIM2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZSWIM2.