ZSCAN9 (zinc finger and SCAN domain containing 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7746
Gene name Zinc finger and SCAN domain containing 9
Gene symbol ZSCAN9
Synonyms (NCBI Gene)
PRD51ZNF193
Chromosome 6
Chromosome location 6p22.1
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT449116 hsa-miR-8069 PAR-CLIP 22100165
MIRT449115 hsa-miR-7641 PAR-CLIP 22100165
MIRT449116 hsa-miR-8069 PAR-CLIP 22100165
MIRT449115 hsa-miR-7641 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 20211142, 25416956, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602246 12984 ENSG00000137185
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15535
Protein name Zinc finger and SCAN domain-containing protein 9 (Cell proliferation-inducing gene 12 protein) (PRD51) (Zinc finger protein 193)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 254 → 276 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 → 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 282 → 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 → 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 → 388 Zinc finger, C2H2 type Domain
PF02023 SCAN 48 → 137 SCAN domain Domain
Sequence 
MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCY
QETPGPREALTRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESG
EEAVILLEDLERELDEPQHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSA
QKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTWEVSQQDPSHGEVGEHKDR
IERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSSGLFNH
RGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIEHQRSH
TGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV
Sequence length 394
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
13
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (13)
Phenotype Name Clinical Significance Source Reference Evidence Score
AUTISM SPECTRUM DISORDER — GWAS catalog 28540026
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS — GWAS catalog 39620209
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE — GWAS catalog 33106845
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DENTAL CARIES — GWAS catalog 39192244
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 23223422 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Child Development Disorders, Pervasive Development Disorder GWASCAT_DG 28540026
★★★★★
★☆☆☆☆
Found in Text Mining only
Hemochromatosis Hemochromatosis Pubtator 18990219 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia GWASCAT_DG 28540026
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
FLOT1 2 shared diseasesDental caries, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Dental caries), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Dental caries, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog. GNL1 2 shared diseasesDental caries, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Dental caries), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Dental caries, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog. BTN3A2 3 shared diseasesInterstitial cystitis, Dental caries, Upper aerodigestive tract neoplasm 3 shared evidence sourcesGWAS catalog (Interstitial cystitis), GWAS catalog (Dental caries), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 3 shared diseases including Interstitial cystitis, Dental caries — evidence mostly GWAS catalog. TRIM40 2 shared diseasesInterstitial cystitis, Dental caries 2 shared evidence sourcesGWAS catalog (Interstitial cystitis), GWAS catalog (Dental caries) Related via 2 shared diseases including Interstitial cystitis, Dental caries — evidence mostly GWAS catalog. PRUNE2 2 shared diseasesDental caries, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Dental caries), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Dental caries, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog.
Lung cancer Linked via 2 of 5 related genesGNL1, BTN3A2 Bipolar disorder Linked via 2 of 5 related genesBTN3A2, TRIM40 Inflammatory bowel disease Linked via 2 of 5 related genesBTN3A2, TRIM40 Breast neoplasms Linked via 1 of 5 related genesBTN3A2 Gastroesophageal reflux disease Linked via 1 of 5 related genesBTN3A2