ZSCAN4 (zinc finger and SCAN domain containing 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 201516
• Gene name: Zinc finger and SCAN domain containing 4
• Gene symbol: ZSCAN4
• Synonyms (NCBI Gene): ZNF494
• Chromosome: 19
• Chromosome location: 19q13.43
• Summary: The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zal

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023361	hsa-miR-122-5p	Microarray	17612493
MIRT1543898	hsa-miR-451b	CLIP-seq
MIRT1543899	hsa-miR-4696	CLIP-seq
MIRT1543900	hsa-miR-488	CLIP-seq
MIRT2696447	hsa-miR-3614-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000781	Component	Chromosome, telomeric region	ISS	20336070
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010833	Process	Telomere maintenance via telomere lengthening	ISS	20336070
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045950	Process	Negative regulation of mitotic recombination	ISS	20336070
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 613419
• HGNC: 23709
• e!Ensembl: ENSG00000180532

Protein

• UniProt ID: Q8NAM6
• Protein name: Zinc finger and SCAN domain-containing protein 4 (Zinc finger protein 494)
• Protein function: Embryonic stem (ES) cell-specific transcription factor required to regulate ES cell pluripotency. Binds telomeres and plays a key role in genomic stability in ES cells by regulating telomere elongation. Acts as an activator of spontaneous telome
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	368 → 390	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	312 → 334	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	340 → 362	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	396 → 418	Zinc finger, C2H2 type	Domain
  PF02023	SCAN	40 → 129	SCAN domain	Domain

• Sequence:

  MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQ
  ELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIE
  DLTDDSINPPALVHVHMQGQEALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQD
  TSLETGQGYEDEQDGWNSSSKTTRVNENITNQGNQIVSLIIIQEENGPRPEEGGVSSDNP
  YNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGNSTCEV
  HQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISDLRVHQI
  IHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
  ITLPSVPSTPEAS

• Sequence length: 433

Related Genes

No strongly related genes found yet for ZSCAN4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZSCAN4.