ZSCAN21 (zinc finger and SCAN domain containing 21)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7589
• Gene name: Zinc finger and SCAN domain containing 21
• Gene symbol: ZSCAN21
• Synonyms (NCBI Gene): NY-REN-21, ZNF38, Zipro1
• Chromosome: 7
• Chromosome location: 7q22.1

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT447327	hsa-miR-4282	PAR-CLIP	22100165
MIRT447326	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447325	hsa-miR-4635	PAR-CLIP	22100165
MIRT447324	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT447323	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT447322	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447321	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT447327	hsa-miR-4282	PAR-CLIP	22100165
MIRT447326	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447325	hsa-miR-4635	PAR-CLIP	22100165
MIRT447324	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT447323	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT447322	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT447321	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT1543579	hsa-miR-561	CLIP-seq
MIRT2673665	hsa-miR-3942-3p	CLIP-seq
MIRT2673666	hsa-miR-4509	CLIP-seq
MIRT2673667	hsa-miR-4744	CLIP-seq
MIRT2673668	hsa-miR-4799-5p	CLIP-seq
MIRT1543579	hsa-miR-561	CLIP-seq
MIRT2673669	hsa-miR-618	CLIP-seq
MIRT2673665	hsa-miR-3942-3p	CLIP-seq
MIRT2673666	hsa-miR-4509	CLIP-seq
MIRT2673667	hsa-miR-4744	CLIP-seq
MIRT2673668	hsa-miR-4799-5p	CLIP-seq
MIRT1543579	hsa-miR-561	CLIP-seq
MIRT2673669	hsa-miR-618	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19549071
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19549071
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	19549071, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	19549071
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007141	Process	Male meiosis I	IEA
GO:0007141	Process	Male meiosis I	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19549071
GO:0046872	Function	Metal ion binding	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 601261
• HGNC: 13104
• e!Ensembl: ENSG00000166529

Protein

• UniProt ID: Q9Y5A6
• Protein name: Zinc finger and SCAN domain-containing protein 21 (Renal carcinoma antigen NY-REN-21) (Zinc finger protein 38 homolog) (Zfp-38)
• Protein function: Strong transcriptional activator (By similarity). Plays an important role in spermatogenesis; essential for the progression of meiotic prophase I in spermatocytes (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	277 → 299	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	305 → 327	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	360 → 382	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	388 → 410	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	416 → 438	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	444 → 466	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	334 → 354	Zinc finger, C2H2 type	Domain
  PF02023	SCAN	41 → 130	SCAN domain	Domain

• Sequence:

  MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKYLPSLEMFRQRFRQFGYHDTPGPR
  EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLL
  EDLERELDEPGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYI
  QESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQ
  CVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHT
  GEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPY
  QCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKE
  CGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP

• Sequence length: 473

Related Genes

No strongly related genes found yet for ZSCAN21.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZSCAN21.