ZRSR2P1 (ZRSR2 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7310
Gene name ZRSR2 pseudogene 1
Gene symbol ZRSR2P1
Synonyms (NCBI Gene)
U2AF1-RS1U2AF1L1U2AF1PU2AF1RS1U2AFBPLZC3H21ZRSR1
Chromosome 5
Chromosome location 5q22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183, 32814053, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
601079 12456 ENSG00000212643
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15695
Protein name U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 1) (U2(RNU2) small nuclear RNA auxiliary factor 1-like 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 245 → 303 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00642 zf-CCCH 172 → 198 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00642 zf-CCCH 312 → 337 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Sequence 
MAALEKMTFPKKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQEEEEDTFIEE
QQLEEEKLLERERERLHEEWLLREQKAQEEFRIKKEKEEAAKKWLEEQERKLKEQWKEQQ
RKEREEEEQKQQEKKEKEEAVQKMLDQAENDLENSTTWQNPEPPVDFRVMEKDRANCPFY
SKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQ
FLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGR
QLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSSDQTGS
SFGKNSERREKMGHHDHYYSRQRGRRNPSPDHTYKRNGESERKKSSHRGKKSHKRTSKSR
ERHNSPSRGRNRHRSWDQGRRSQSRRSHRSRSQSSSRCRSRGRRKSGNRDRTVQSPQSK
Sequence length 479
Interactions View interactions

No strongly related genes found yet for ZRSR2P1.

No additional diseases found yet through genes similar to ZRSR2P1.