Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	124626
Gene name	Zona pellucida binding protein 2
Gene symbol	ZPBP2
Synonyms (NCBI Gene)	ZPBPL
Chromosome	17
Chromosome location	17q21.1

24 Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017875	hsa-miR-335-5p	Microarray	18185580
MIRT1543373	hsa-miR-185	CLIP-seq
MIRT1543374	hsa-miR-4306	CLIP-seq
MIRT1543375	hsa-miR-4644	CLIP-seq
MIRT1543376	hsa-miR-4802-5p	CLIP-seq
MIRT2163954	hsa-miR-1323	CLIP-seq
MIRT2163955	hsa-miR-3148	CLIP-seq
MIRT2163956	hsa-miR-3978	CLIP-seq
MIRT2163957	hsa-miR-548a-3p	CLIP-seq
MIRT2163958	hsa-miR-548an	CLIP-seq
MIRT2163959	hsa-miR-548e	CLIP-seq
MIRT2163960	hsa-miR-548f	CLIP-seq
MIRT2163961	hsa-miR-548g	CLIP-seq
MIRT2163962	hsa-miR-548o	CLIP-seq
MIRT2383119	hsa-miR-3120-3p	CLIP-seq
MIRT2383120	hsa-miR-331-5p	CLIP-seq
MIRT2383121	hsa-miR-3617	CLIP-seq
MIRT2383122	hsa-miR-3914	CLIP-seq
MIRT2383123	hsa-miR-3928	CLIP-seq
MIRT2383124	hsa-miR-4672	CLIP-seq
MIRT2383125	hsa-miR-4802-3p	CLIP-seq
MIRT1543376	hsa-miR-4802-5p	CLIP-seq
MIRT2383126	hsa-miR-641	CLIP-seq
MIRT2383127	hsa-miR-765	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001675	Process	Acrosome assembly	IBA
GO:0001675	Process	Acrosome assembly	IEA
GO:0002199	Component	Zona pellucida receptor complex	IBA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0002638	Process	Negative regulation of immunoglobulin production	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IBA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0044297	Component	Cell body	IEA
GO:0046466	Process	Membrane lipid catabolic process	IEA

MIM	HGNC	e!Ensembl
608499	20678	ENSG00000186075

Q6X784

Protein name

Zona pellucida-binding protein 2 (ZPBP-like protein)

Protein function

Is implicated in sperm-oocyte interaction during fertilization.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07354	Sp38	150 → 327	Zona-pellucida-binding protein (Sp38)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in testis. {ECO:0000269|PubMed:17664285}.

Sequence

MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKL
SKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAET
QEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSC
HVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDR
IEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCS
PATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED

Sequence length

338

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (26)
ANKYLOSING SPONDYLITIS	—	GWAS catalog	26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	27130862, 27182965, 28461288, 29273806, 31036433, 31669095, 35126453, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	29892015, 30061737, 35872910, 36653681, 39024449, 39537608, 40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	26301688, 30572963	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	38616254	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	35126453	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	23817570, 30412241	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	23817570, 30412241	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	29273806, 31036433, 31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	18587394, 21102463, 26192919, 26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	18587394, 21102463, 26192919, 38616254	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	22961000	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	20453842, 23143596, 24532676, 30423114, 30572963, 33310728, 36762574, 40262193	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	30013184	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26301688, 36750564	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	30572963	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	21829393, 25751624, 26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	21829393, 25751624	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	21297633, 26192919, 26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (29)
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19732864, 21985515, 22271045, 25895113, 27835674, 27848966, 28241063, 31439681, 32240371, 33653805, 36967681	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19732864, 22271045, 23546690, 25433770, 26671913, 27130862, 28241063, 29536159		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	20860503, 21804549		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	27182965		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19732864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19732864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASDB_DG	17611496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26484354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26484354	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	29510406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	21594610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	25895113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26484354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26484354	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28588209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22464253, 25271777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22464253, 28427360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	22936693, 22961000		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28588209		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30423114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GSDMB	10	["Atrial flutter","Autoimmune disease","Autoimmune thyroid disease","B-cell acute lymphoblastic leukemia","Celiac disease","Cervical cancer","Common variable immunodeficiency","Juvenile idiopathic arthritis","Biliary cholangitis","Systemic sclerosis"]	[]	11	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Atrial flutter)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (B-cell acute lymphoblastic leukemia)","GWAS catalog (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Biliary cholangitis)","GWAS catalog (Systemic sclerosis)"]
GPR35	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis","Sclerosing cholangitis"]	[]	7	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Sclerosing cholangitis)"]
NKD1	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis","Sclerosing cholangitis"]	[]	7	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Sclerosing cholangitis)"]
ERAP2	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis","Sclerosing cholangitis"]	[]	7	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Sclerosing cholangitis)"]
ATG16L1	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis","Sclerosing cholangitis"]	[]	7	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Sclerosing cholangitis)"]

ZPBP2 (zona pellucida binding protein 2)

Save This Analysis