ZNRD2 (zinc ribbon domain containing 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10534
Gene name Zinc ribbon domain containing 2
Gene symbol ZNRD2
Synonyms (NCBI Gene)
SSSCA1p27
Chromosome 11
Chromosome location 11q13.1
Summary This antigen is recognized by a subset of anti-centromere antibodies from patients with scleroderma and/or Sjogren`s syndrome. Subcellular localization has not yet been established. [provided by RefSeq, Jul 2008]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle TAS 9486406
GO:0005515 Function Protein binding IPI 16189514, 22190034, 25416956, 25910212, 31515488, 32296183, 35271311
GO:0005737 Component Cytoplasm IEA
GO:0042802 Function Identical protein binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606044 11328 ENSG00000173465
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60232
Protein name Protein ZNRD2 (Autoantigen p27) (Protein zinc ribbon domain type 2) (Sjoegren syndrome/scleroderma autoantigen 1) (Zinc ribbon domain-containing protein 2)
Protein function Might play a role in mitosis. Antigenic molecule. Could be a centromere-associated protein. May induce anti-centromere antibodies.
PDB 6HCZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06677 Auto_anti-p27 36 → 74 Family
Sequence 
MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVP
RPEHCEGAAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQL
CGLIRACAEALRSLQQLQH
Sequence length 199
Interactions View interactions

No strongly related genes found yet for ZNRD2.

No additional diseases found yet through genes similar to ZNRD2.