ZNF888 (zinc finger protein 888)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 388559
Gene name Zinc finger protein 888
Gene symbol ZNF888
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.41
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CJ79
Protein name Zinc finger protein 888
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 326 → 348 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 438 → 460 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 466 → 488 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 354 → 376 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 298 → 320 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 690 → 712 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 606 → 628 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 270 → 292 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 550 → 572 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 522 → 544 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 382 → 404 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 634 → 656 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 494 → 516 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 578 → 600 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 410 → 432 Zinc finger, C2H2 type Domain
PF01352 KRAB 7 → 48 KRAB box Family
Sequence 
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMEFSSI
GKGNTEVIHTGTLQRLASHHIGECCFQEIEKDIHDFVFQWQEDETNGHEAPMTEIKELTG
STDQYDQRHAGNKPIKYQLGSSFHSHLPELHIFQPEGKIGNQLEKSINNASSVSTSQRIS
CRPKTHISNNYGNNFFHSSLLTQKQDVHRKEKSFQFNESGKSFNCSSLFKKHQIIHLGEK
QYKCDVCGKDFNQKRYLAHHRRCHTGEKPYMCNKCGKVFNKKAYLARHYRRHTGEKPYKC
NECGKTFSDKSALLVHKTIHTGEKPYKCNECGKVFNQQSNLARHHRVHTGEKPYQCKECD
KVFSRKSYLERHRRIHTGEKPYKCKVCDKAFRHDSHLAQHIVIHTREKPYKCNECGKTFG
ENSALLVHKTIHTGEKPYKCNECGKVFNQQSNLARHHRLHTGEKPYKCKECDKVFSRKSH
LERHRRIHTGEKPYKCKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECGKTFVQNSSLVMH
KVIHTGEKRYKCNECGKSFNHKSSLAYHHRLHTGEKPYKCNECGKVFRTQSQLACHHRLH
TGEKPYKCEECDKVFNIKSHLEIHRRVHTGEKPYKCRVCDKAFGRDSYLAQHQRVHTGEK
PYKCKVCDKAFKCYSHLAQHTRIHTGEKPFKCSECGKAFRAQSTLIHHQAIHGVGKLD
Sequence length 718
Interactions View interactions

No strongly related genes found yet for ZNF888.

No additional diseases found yet through genes similar to ZNF888.