ZNF883 (zinc finger protein 883)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 169834
Gene name Zinc finger protein 883
Gene symbol ZNF883
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q32
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CG24
Protein name Zinc finger protein 883
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 41 → 63 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 69 → 91 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 265 → 287 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 237 → 259 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 321 → 343 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 153 → 175 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 97 → 119 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 125 → 147 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 209 → 231 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 181 → 203 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 293 → 315 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 349 → 371 Zinc finger, C2H2 type Domain
Sequence 
MESEKIYMTANPYLCTECGKGYTCLASLTQHQKTHIGEKPYECKICGKSFTRNSNLVQHQ
RIHTGEKPYECNECGKAFSQSTNLIQHQRVHTGEKPYECNECEKTFSHRSSLRNHERIHT
GEKPYPCNECGKAFSHISALTQHHRIHTGKKPYECTECGKTFSRSTHLIEHQGIHSEEKS
YQCKQCRKVFCHSTSLIRHQRTHTGEKPYECNECGKAFSHTPAFIQHQRIHTGEKPYECN
ACGKAFNRSAHLTEHQRTHTGEKPYVCKECGKTFSRSTHLTEHLKIHSCVKPYQCNECQK
LFCYRTSLIRHQRTHTGEKPYQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCH
STSLIRHQKTHFRKETLAE
Sequence length 379
Interactions View interactions

No strongly related genes found yet for ZNF883.

No additional diseases found yet through genes similar to ZNF883.