ZNF876P (zinc finger protein 876, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 642280
Gene name Zinc finger protein 876, pseudogene
Gene symbol ZNF876P
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4p16.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q49A33
Protein name Putative zinc finger protein 876
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 63 → 85 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 119 → 141 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 91 → 113 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 175 → 196 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 147 → 169 Zinc finger, C2H2 type Domain
Sequence 
MHTGEKPYTCEECVKLLTNPQALLYTGAFILNKNFTNVKNAAKPLLNPHPLINKRIHTGE
KPYTCEECGKAFYRSSHLTEHKNIHTGEKSYKCEECGNAFYRSSHLTKHKRIHSGQKPYK
CEECGKAFRQSSALNEHKKIHTAEKPYKCKECGKAFRWSRSLNEHTNIHIGEKPYTCEEC
GKDFTWSSTLTVHQRIQTGEKHS
Sequence length 203
Interactions View interactions

No strongly related genes found yet for ZNF876P.

No additional diseases found yet through genes similar to ZNF876P.