ZNF861P (zinc finger protein 861, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100302737
Gene name Zinc finger protein 861, pseudogene
Gene symbol ZNF861P
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0008270 Function Zinc ion binding IEA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60384
Protein name Putative zinc finger protein 861
Family and domains
Sequence 
MWLSTSPYRKGSQCGEAFSQIPGHNLNKKTPPGVKPPESHVCGEVGVGYPSTERHIRDRL
GRKPCEYQECRQKAYTCKPCGNAFRFHHSFHIHERPHSGENLYEC
Sequence length 105
Interactions View interactions

No strongly related genes found yet for ZNF861P.

No additional diseases found yet through genes similar to ZNF861P.