ZNF840P (zinc finger protein 840, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100533646
Gene name Zinc finger protein 840, pseudogene
Gene symbol ZNF840P
Synonyms (NCBI Gene)
C20orf157ZNF840dJ981L23.3
Chromosome 20
Chromosome location 20q13.12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 34344 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NDX5
Protein name Zinc finger protein 840
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 473 → 495 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 661 → 683 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 605 → 627 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 501 → 523 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 417 → 439 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 361 → 383 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 689 → 711 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 549 → 571 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 207 → 229 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 151 → 173 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 235 → 257 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 633 → 655 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 305 → 327 Zinc finger, C2H2 type Domain
PF01352 KRAB 41 → 82 KRAB box Family
PF13912 zf-C2H2_6 333 → 358 Domain
PF13912 zf-C2H2_6 388 → 414 Domain
PF13912 zf-C2H2_6 577 → 602 Domain
Sequence 
MSLMGHGKVEMLLYAVPLLKAPNCLSSSMQLPHGGGRHQELVRFRDVAVVFSPEEWDHLT
PEQRNLYKDVMLDNCKYLASLGNWTYKAHVMSSLKQGKEPWMMEREVTGDPCPACQPALA
TFRALNESGNAFRQSFHHGEYRTHRTFVQHYECDDCGMAFGHVSQLTGHQKIHKVGETHE
YGENTRGFRHRSSFTMLQRICTLYKHFECNQCGETFNRPSKVIQHQSMHSGLKPYKCDVC
QKAFRFLSSLSIHQRFHVGNRVNLTRHQKTHTQRKPFSCNFCGKTFHRFSEKTQHLLIHT
RKKYYTCNYCKKEFNPYSKFILHQRTHTGEKPHKCDVCEKSFKSISNLNKHQKTHTGEKP
FSCNECKKTFAQRTDLARHQQIHTGKKSFICSSCKKTFVRLSDLTQHKGTHTGERPYQCT
TCEKAFKYRSNFTKHQKTHSIGRPFACNECGKTYRLNWELNQHKKIHTGEKPYECGECGK
RFNNNSNLNKHKKIHTGEKHFVCNQCGKAFSLNSKLSRHQRTHNKKENSSKSVSNLNKHQ
KTHAGEKPFPCNECKKAFAQRMDLARHQQIHTGRKPFICSSCKKTFVRLSDLTQHKGTHT
GERPYQCTTCEKAFKYQSNFTKHQKTHSIGRPFTCNECGKTFRLNWKLNQHKKIHTGEKP
YECGECGKCFNNNSNLSKHKKIHTGEKHFVCNQCGKAFSLNSKLSRHQITHNKKKP
Sequence length 716
Interactions View interactions

No strongly related genes found yet for ZNF840P.

No additional diseases found yet through genes similar to ZNF840P.