ZNF833P (zinc finger protein 833, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401898
Gene name Zinc finger protein 833, pseudogene
Gene symbol ZNF833P
Synonyms (NCBI Gene)
ZNF833
Chromosome 19
Chromosome location 19p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005634 Component Nucleus IBA
GO:0005694 Component Chromosome IEA
GO:0008270 Function Zinc ion binding IEA
GO:0010468 Process Regulation of gene expression IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZTB9
Protein name Putative zinc finger protein 833
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 122 → 144 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 66 → 88 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 94 → 116 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 10 → 32 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 38 → 60 Zinc finger, C2H2 type Domain
Sequence 
MVMHSEDEPYKCKFCGKAFDNLHLYLTHERTHTGEKPYECNKCGKAFSCSSSIRKHARIH
TGEKPYICKQCGKAFRYSSSIRNHENTHTGEKPCECKQCGKAFSYSSYFRIHERIHTGEQ
VYKCKECGKTFTYPSAFHKHKSTHTSQKLYECKECGKAFDCFSSFHSHEGVHTGEKPYEC
RTWKSLQ
Sequence length 187
Interactions View interactions

No strongly related genes found yet for ZNF833P.

No additional diseases found yet through genes similar to ZNF833P.