ZNF826P (zinc finger protein 826, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 664701
Gene name Zinc finger protein 826, pseudogene
Gene symbol ZNF826P
Synonyms (NCBI Gene)
ZNF826
Chromosome 19
Chromosome location 19p12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZT77
Protein name Putative zinc finger protein 826
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 148 → 170 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 120 → 137 Zinc finger, C2H2 type Domain
Sequence 
MRRFILERNPTNVKNMAKLSPIPHTLLGIRKFMLERNHTSVINVAQPLFYPQPLVNMRRF
ILERNSTNVKNVAKPSTIFHTLLYIRQFILERNAINGIKTFTWSSSPHKHRRTHTGEKPY
KCEECGKAFTASSTLSEYKTIHTGEKPCKCEECGKAFNWSSDFNKHKRIHSGQKPIL
Sequence length 177
Interactions View interactions

No strongly related genes found yet for ZNF826P.

No additional diseases found yet through genes similar to ZNF826P.