ZNF818P (zinc finger protein 818, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 390963
Gene name Zinc finger protein 818, pseudogene
Gene symbol ZNF818P
Synonyms (NCBI Gene)
ZNF818
Chromosome 19
Chromosome location 19q13.42
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005634 Component Nucleus IEA
GO:0008270 Function Zinc ion binding IEA
GO:0043565 Function Sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 33265 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZRF7
Protein name Putative zinc finger protein 818
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 89 → 111 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 64 → 83 Zinc finger, C2H2 type Domain
Sequence 
MLERNLTSMMSVEEPLPRPLTSLYIRLSILERNHMNMTYMAKSSVKIHISKVIIGFVLKR
SLTNVCGKVLSQNSHLVNHQRIHTGEKSYRCHECGKAFTQGSRFINHQIVHTGENFPNVL
NVARLLRMALNSGLTK
Sequence length 136
Interactions View interactions

No strongly related genes found yet for ZNF818P.

No additional diseases found yet through genes similar to ZNF818P.