ZNF815P (zinc finger protein 815, pseudogene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 401303 |
| Gene name | Zinc finger protein 815, pseudogene |
| Gene symbol | ZNF815P |
| Synonyms (NCBI Gene) |
ZNF815
|
| Chromosome | 7 |
| Chromosome location | 7p22.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A8K554 |
| Protein name | Putative protein ZNF815 |
| Family and domains | |
| Sequence |
MEEEEIRTWSFPEEVWQVATQPDSQQQHEDQHLSHTFLDKKDWTGNELHECNELGKKLHQ |
| Sequence length | 130 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ZNF815P across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ZNF815P (see Related Genes above), that are NOT already directly curated for ZNF815P itself -- a lead worth checking, not a confirmed association.
0
|
|