ZNF788P (zinc finger family member 788, pseudogene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 388507 |
| Gene name | Zinc finger family member 788, pseudogene |
| Gene symbol | ZNF788P |
| Synonyms (NCBI Gene) |
ZNF788
|
| Chromosome | 19 |
| Chromosome location | 19p13.2 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
|
||||||||||||||||
|
||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q6ZQV5 | ||||||||||
| Protein name | Putative KRAB domain-containing protein ZNF788 (Zinc finger family member 788, pseudogene) | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MRNMIPQDNENPPQQGEANQNDSVAFEDVAVNFTPDEWALLDPSQKNLYREVMQETLRNL |
||||||||||
| Sequence length | 82 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with ZNF788P across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ZNF788P (see Related Genes above), that are NOT already directly curated for ZNF788P itself -- a lead worth checking, not a confirmed association.
0
|
|