ZNF777 (zinc finger protein 777)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 27153
• Gene name: Zinc finger protein 777
• Gene symbol: ZNF777
• Synonyms (NCBI Gene): -
• Chromosome: 7
• Chromosome location: 7q36.1

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044310	hsa-miR-106b-5p	CLASH	23622248
MIRT040887	hsa-miR-18a-3p	CLASH	23622248
MIRT038430	hsa-miR-296-3p	CLASH	23622248
MIRT1539366	hsa-miR-140-3p	CLIP-seq
MIRT1539367	hsa-miR-144	CLIP-seq
MIRT1539368	hsa-miR-548ag	CLIP-seq
MIRT1539369	hsa-miR-548ai	CLIP-seq
MIRT1539370	hsa-miR-548m	CLIP-seq
MIRT1539371	hsa-miR-944	CLIP-seq
MIRT2162943	hsa-miR-2355-5p	CLIP-seq
MIRT2162944	hsa-miR-4290	CLIP-seq
MIRT2162945	hsa-miR-4726-3p	CLIP-seq
MIRT2162946	hsa-miR-937	CLIP-seq
MIRT2382053	hsa-miR-4488	CLIP-seq
MIRT2382054	hsa-miR-4697-5p	CLIP-seq
MIRT2382055	hsa-miR-637	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	34673265
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	25560148
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	25560148
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	31856708
GO:0046872	Function	Metal ion binding	IEA
GO:0051291	Process	Protein heterooligomerization	IDA	31856708

Other IDs

• MIM: 619298
• HGNC: 22213
• e!Ensembl: ENSG00000196453

Protein

• UniProt ID: Q9ULD5
• Protein name: Zinc finger protein 777
• Protein function: May be involved in transcriptional repression (PubMed:31856708). Inhibits cell proliferation through CDKN1A/p21 induction by down-regulation of NIBAN1/FAM129A at low cell density (PubMed:25560148). {ECO:0000269|PubMed:25560148, ECO:0000269|PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	694 → 716	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	636 → 658	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	750 → 772	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	546 → 568	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	664 → 686	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	574 → 596	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	778 → 800	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	722 → 744	Zinc finger, C2H2 type	Domain
  PF01352	KRAB	284 → 325	KRAB box	Family
  PF12417	DUF3669	188 → 255	Zinc finger protein	Family

• Sequence:

  MENQRSSPLSFPSVPQEETLRQAPAGLPRETLFQSRVLPPKEIPSLSPTIPRQGSLPQTS
  SAPKQETSGRMPHVLQKGPSLLCSAASEQETSLQGPLASQEGTQYPPPAAAEQEVSLLSH
  SPHHQEAPVHSPEAPEKDPLTLSPTVPETDMDPLLQSPVSQKDTPFQISSAVQKEQPLPT
  AEITRLAVWAAVQAVERKLEAQAMRLLTLEGRTGTNEKKIADCEKTAVEFANHLESKWVV
  LGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQEWG
  NLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGERPTMQEQEDSEEGETPTDP
  SAAHDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEPEN
  TLEESTEGSSEFSELKQMLVQQRNCTEGIVIKTEEQDEEEEEEEEDELPQHLQSLGQLSG
  RYEASMYQTPLPGEMSPEGEESPPPLQLGNPAVKRLAPSVHGERHLSENRGASSQQQRNR
  RGERPFTCMECGKSFRLKINLIIHQRNHIKEGPYECAECEISFRHKQQLTLHQRIHRVRG
  GCVSPERGPTFNPKHALKPRPKSPSSGSGGGGPKPYKCPECDSSFSHKSSLTKHQITHTG
  ERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGER
  PFKCPECEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHC
  AECGKRFTQKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLRTHTGE

• Sequence length: 831

Pathways

Reactome Pathway:

Generic Transcription Pathway

Related Genes

No strongly related genes found yet for ZNF777.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZNF777.