ZNF75CP (zinc finger protein 75C, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 729944
Gene name Zinc finger protein 75C, pseudogene
Gene symbol ZNF75CP
Synonyms (NCBI Gene)
ZNF75C
Chromosome 11
Chromosome location 11q14.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 13148 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92670
Protein name Putative zinc finger protein 75C (Zinc finger protein 75C pseudogene)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 292 → 314 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 404 → 426 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 376 → 398 Zinc finger, C2H2 type Domain
PF01352 KRAB 204 → 245 KRAB box Family
PF02023 SCAN 45 → 134 SCAN domain Domain
Sequence 
MIMRELKADACLNSHMGAMWETNRSVKENSSQSKKYSTQIECLSPGSACRHFRSFHYHEA
TEPLEAINQLQKLCHQWLRPEIHSKKHILEMLVLEHFLTILPKGTQNWVQKHHPQLAKQA
LVLVERLQREPGGTKNEVTAHELGEEAVLLRGTTVAPGFKWKPAELEPMERILEHIQILA
LSEHKSTKDWKMAPKLIWPESQSLLTFEDMAVYFSEEEWQLLGPLEKTLYNDVMQDIYET
AISLGKQRTGKIMGIEMASSFSKEEKKLTTCKQELPKLMDLHGKGHTGEKPFKCQDCGKI
FRVSSDLIKHQRIHTEEKLYKCQQCDRRFRWSSGLNKHFMTHQGINPYRCSWYGKSISYD
TNLQTHQRIHTGEKPFKCHECGKIFIHKSNLIKYQRTHTGEQPYTCSICRRNFSRQLSLL
RHQKLH
Sequence length 426
Interactions View interactions

No strongly related genes found yet for ZNF75CP.

No additional diseases found yet through genes similar to ZNF75CP.