ZNF726P1 (zinc finger protein 726 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7618
Gene name Zinc finger protein 726 pseudogene 1
Gene symbol ZNF726P1
Synonyms (NCBI Gene)
ZNF67ZNF67P
Chromosome 19
Chromosome location 19p12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0005634 Component Nucleus IBA
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 13136 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15940
Protein name Putative zinc finger protein 726P1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 102 → 124 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 46 → 67 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 158 → 180 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 74 → 91 Zinc finger, C2H2 type Domain
Sequence 
MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEECGKAFKQHST
LTTHKIICAEEKLYRCEECGKAFCQPSTLTRYKRMHRRKKLYKCEECGKAFTQFSTLTKH
KRIHTRGKHYKCEESGKAFIWSSGLTEHRRVHTRQKPYKCEECGKALIQFSTLTRHKRIH
TGEKPNKSMWQTF
Sequence length 193
Interactions View interactions

No strongly related genes found yet for ZNF726P1.

No additional diseases found yet through genes similar to ZNF726P1.