ZNF705B (zinc finger protein 705B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100132396
Gene name Zinc finger protein 705B
Gene symbol ZNF705B
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8p23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CI00
Protein name Zinc finger protein 705B
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 228 → 250 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 200 → 222 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 172 → 194 Zinc finger, C2H2 type Domain
PF01352 KRAB 6 → 47 KRAB box Family
Sequence 
MHSLEKVTFEDVAIDFTQEEWDMMDTSKRKLYRDVMLENISHLVSLGYQISKSYIILQLE
QGKELWWEGRVFLQDQNPDRESALKKKHMISMHPIIRKDTSTSMTMENSLILEDPFEYND
SGEDCTHSSTITQCLLTHSGKKPCVSKQCGKSLRNLLSPKPRKQIHTKGKSYQCNLCEKA
YTNCFYLRRHKMTHTGERPYACHLCGKAFTQCSHLRRHEKTHTGERPYKCHQCGKAFIQS
FNLRRHERTHLGQKCYECDKSGKAFSQSSGFRGNKIIHIGEKPPACLLCGKAFSLSSDLR
Sequence length 300
Interactions View interactions

No strongly related genes found yet for ZNF705B.

No additional diseases found yet through genes similar to ZNF705B.