ZNF702P (zinc finger protein 702, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 79986
Gene name Zinc finger protein 702, pseudogene
Gene symbol ZNF702P
Synonyms (NCBI Gene)
ZNF702
Chromosome 19
Chromosome location 19q13.41
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H963
Protein name Putative zinc finger protein 702
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 62 → 84 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 90 → 112 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 34 → 56 Zinc finger, C2H2 type Domain
Sequence 
MREKSFQCNESGKAFNCSSLLKKCQIIHLGEKKYKCDICGKVFNQKRYLAYHHRCHTGEK
PYKCNQCGKTFSYKSSLVIHKAIHTGEKPHKCNECGKVFNQKAYLASHHRLHTGEKPYKC
EECDKVFSR
Sequence length 129
Interactions View interactions

No strongly related genes found yet for ZNF702P.

No additional diseases found yet through genes similar to ZNF702P.