ZNF658B (zinc finger protein 658B (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401509
Gene name Zinc finger protein 658B (pseudogene)
Gene symbol ZNF658B
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9p12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q4V348
Protein name Zinc finger protein 658B
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 726 → 748 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 334 → 356 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 418 → 440 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 200 → 222 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 754 → 776 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 698 → 720 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 642 → 663 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 614 → 636 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 446 → 468 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 586 → 608 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 558 → 580 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 474 → 496 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 362 → 384 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 782 → 805 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 390 → 412 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 530 → 552 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 278 → 300 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 306 → 328 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 670 → 692 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 502 → 524 Zinc finger, C2H2 type Domain
Sequence 
MMNLEKNFDKTTLFNHMRTDKRGKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGI
NFSRKSPLTQSQRTITGWSAFESNKCEENFSQSSAHIVHQKTQAGDKFGEHNECTDALYQ
KLDFTAHQRIHTDFTAHQKFYLSDEHGKCRKSFYWKAHLIQHERPHSGEKTYQYEECAKS
FCSSSHPIQHPGTYVGFKLYECNECGKAFCQNSNLSKHLRIHTKEKPCDNNGCGRSYKSP
LIGHQKTDAEMELCGGSEYGKTSHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIH
TGEKPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEK
PYECSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTREKPYEC
NECGRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYKCNECE
KTFAHNSALRAHQNIHTGEKLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFS
QKSYLSGHERIHTGEKPYECNVCGKTFVYKAALIVHQRIHTGEKPYECNECGKTFSQRTH
LCAHQRIHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNDCGKTFSKTSHLRAH
LRTRSGEKPYECSECGKTFSEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQRIH
TGEKSYECNDCGKTFSQKSHLSAHQRIHTGEKPYECNECGKAFAQNSTLRVHQRIHTGEK
PYECDECGKTFVRKAALRVHHTRMHTREKTLACNGFGKS
Sequence length 819
Interactions View interactions

No strongly related genes found yet for ZNF658B.

No additional diseases found yet through genes similar to ZNF658B.