ZNF658 (zinc finger protein 658)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 26149
Gene name Zinc finger protein 658
Gene symbol ZNF658
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q21.11
miRNA miRNA information provided by mirtarbase database.
22 Show/Hide all (22)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT023238 hsa-miR-122-5p Microarray 17612493
MIRT1534068 hsa-miR-219-2-3p CLIP-seq
MIRT1534069 hsa-miR-2964a-3p CLIP-seq
MIRT1534070 hsa-miR-3130-3p CLIP-seq
MIRT1534071 hsa-miR-3661 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding IDA 25582195
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616290 25226 ENSG00000274349
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5TYW1
Protein name Zinc finger protein 658
Protein function Mediates transcriptional repression in response to zinc. Represses several genes, including SLC30A5, SLC30A10 and CBWD1, by binding to the zinc transcriptional regulatory element (ZTRE) (5'-C[AC]C[TAG]CC[TC]-N(0-50)-[GA]G[ATC]G[TG]G-3') found in
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 966 → 988 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 574 → 596 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 658 → 680 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 440 → 462 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 994 → 1016 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 938 → 960 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 882 → 903 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 854 → 876 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 686 → 708 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 798 → 820 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 826 → 848 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 714 → 736 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 602 → 624 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 1022 → 1045 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 630 → 652 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 770 → 792 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 518 → 540 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 546 → 568 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 910 → 932 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 742 → 764 Zinc finger, C2H2 type Domain
PF01352 KRAB 7 → 48 KRAB box Family
Sequence 
MNMSQASVSFQDVTVEFTREEWQHLGPVERTLYRDVMLENYSHLISVGYCITKPKVISKL
EKGEEPWSLEDEFLNQRYPGYFKVDHIKGIREKQEKPLWQEIFISDADKTLSKEGQKVLE
KPFNLEIAPELSEKISCKCDSHRMNLPVASQLIISERKYSRKKTEYMNVCEKLQLDIKHE
KAHAEEKSYEHGENAKAFSYKKDQHWKFQTLEESFECDGSGQGLYDKTICITPQSFLTGE
KSCKDDEFRKNFDKITLFNHMRTDTRGKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECN
ERGINFSRKSPLTQSQRTITGWSAFESNKCEENFSQSSAHIVHQKTQAGDKFGEHNECTD
ALYQKLDFTAHQRIHTEDKFYLSDEHGKCRKSFYRKAHLIQHQRPHSGEKTYQYEECAKS
FCSSSHPIQHPGTYVGFKLYECNECGKAFCQNSNLSKHLRIHTKEKPCDNNGCGRSYKSP
LIGHQKTDAEMELCGGSEYGKTSHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIH
TGEKPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEK
PYECSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTGEKPYEC
NECGRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYECNECE
KTFAHNSALRAHQNIHTGEKLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFS
QKSYLSGHERIHTGEKPYECNVCGKTFVYKAALIVHQRIHTGEKPYECNQCGKTFSQRTH
LCAHQRIHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNDCGKTFSKTSHLRAH
LRTRSGEKPYECSECGKTFSEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQRIH
TGEKSYECNDCGKTFSQKSHLSAHQRIHTGEKPYECNECGKAFAQNSTLRVHQRIHTGEK
PYECDECGKTFVRKAALRVHHTRMHTREKTLACNGFGKS
Sequence length 1059
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
SKIN DISEASES — CTD 28720099
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 24105271 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Dermatologic disorders Dermatologic Disorders CTD_human_DG 28720099
★★★★★
★☆☆☆☆
Found in Text Mining only
Skin lesion Skin Lesion BEFREE 28720099
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for ZNF658.

No additional diseases found yet through genes similar to ZNF658.