ZNF587B (zinc finger protein 587B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100293516
Gene name Zinc finger protein 587B
Gene symbol ZNF587B
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.43
miRNA miRNA information provided by mirtarbase database.
22 Show/Hide all (22)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT661844 hsa-miR-548c-3p HITS-CLIP 23824327
MIRT661842 hsa-miR-6733-3p HITS-CLIP 23824327
MIRT661843 hsa-miR-4302 HITS-CLIP 23824327
MIRT661841 hsa-miR-3689a-5p HITS-CLIP 23824327
MIRT661840 hsa-miR-3689b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
E7ETH6
Protein name Zinc finger protein 587B
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 326 → 348 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 270 → 292 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 354 → 375 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 242 → 264 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 298 → 320 Zinc finger, C2H2 type Domain
PF01352 KRAB 14 → 55 KRAB box Family
Sequence 
MAVVATLRLSAQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGV
EDEAAPSKQSIYIQRETQVRTPVTGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLH
RCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFVKRCKLHVSGESSVFSESGKDFL
PRSGLLQQEASHTGEKSNSKTECVSPFQCGGAHYSHGDSMKHFSTKHILSQHQRLLPREE
CYVCCECGKSFSKYVSFSNHQRVHSGKRPYECGECEKSFSQKSSLIQHQQFHTGGKPYGC
EECGKYFSLEGYLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTGERPYKCGECE
KSFSRKPSLSYHQRFGRPRWVDHKDRKEFKTSLGNIVKSCLF
Sequence length 402
Interactions View interactions

No strongly related genes found yet for ZNF587B.

No additional diseases found yet through genes similar to ZNF587B.