Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	147948
Gene name	Zinc finger protein 582
Gene symbol	ZNF582
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.43
Summary	The protein encoded by this gene is a zing finger protein and putative transcription factor that is highly methylated in cervical cancers. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

76 Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT648276	hsa-miR-4282	HITS-CLIP	23824327
MIRT648275	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT648274	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT648273	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT648272	hsa-miR-3163	HITS-CLIP	23824327
MIRT648271	hsa-miR-4310	HITS-CLIP	23824327
MIRT648270	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT648269	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT648268	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT648267	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT648266	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT648265	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT648264	hsa-miR-7977	HITS-CLIP	23824327
MIRT648263	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT648262	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT648261	hsa-miR-514a-3p	HITS-CLIP	23824327
MIRT648260	hsa-miR-514b-3p	HITS-CLIP	23824327
MIRT530769	hsa-miR-548an	PAR-CLIP	22012620
MIRT530768	hsa-miR-3714	PAR-CLIP	22012620
MIRT530767	hsa-miR-3910	PAR-CLIP	22012620
MIRT530766	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT530765	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT530764	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT530763	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT530762	hsa-miR-584-3p	PAR-CLIP	22012620
MIRT530761	hsa-miR-548au-3p	PAR-CLIP	22012620
MIRT530760	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT530759	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT530758	hsa-miR-6878-3p	PAR-CLIP	22012620
MIRT530757	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT648276	hsa-miR-4282	HITS-CLIP	23824327
MIRT648275	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT648274	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT648273	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT648272	hsa-miR-3163	HITS-CLIP	23824327
MIRT648271	hsa-miR-4310	HITS-CLIP	23824327
MIRT648270	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT648269	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT648268	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT648267	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT648266	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT648265	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT648264	hsa-miR-7977	HITS-CLIP	23824327
MIRT648263	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT648262	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT648261	hsa-miR-514a-3p	HITS-CLIP	23824327
MIRT648260	hsa-miR-514b-3p	HITS-CLIP	23824327
MIRT530769	hsa-miR-548an	PAR-CLIP	22012620
MIRT530768	hsa-miR-3714	PAR-CLIP	22012620
MIRT530767	hsa-miR-3910	PAR-CLIP	22012620
MIRT530766	hsa-miR-2682-5p	PAR-CLIP	22012620
MIRT530765	hsa-miR-34b-5p	PAR-CLIP	22012620
MIRT530764	hsa-miR-449c-5p	PAR-CLIP	22012620
MIRT530763	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT530762	hsa-miR-584-3p	PAR-CLIP	22012620
MIRT530761	hsa-miR-548au-3p	PAR-CLIP	22012620
MIRT530760	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT530759	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT530758	hsa-miR-6878-3p	PAR-CLIP	22012620
MIRT530757	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT1530583	hsa-miR-1254	CLIP-seq
MIRT1530584	hsa-miR-3116	CLIP-seq
MIRT1530585	hsa-miR-3529	CLIP-seq
MIRT1530586	hsa-miR-379	CLIP-seq
MIRT1530587	hsa-miR-4420	CLIP-seq
MIRT1530588	hsa-miR-4451	CLIP-seq
MIRT1530589	hsa-miR-4539	CLIP-seq
MIRT1530590	hsa-miR-4650-3p	CLIP-seq
MIRT1530591	hsa-miR-4652-3p	CLIP-seq
MIRT1530592	hsa-miR-4659a-3p	CLIP-seq
MIRT1530593	hsa-miR-4659b-3p	CLIP-seq
MIRT1530594	hsa-miR-4753-3p	CLIP-seq
MIRT1530595	hsa-miR-4764-5p	CLIP-seq
MIRT1530596	hsa-miR-4778-3p	CLIP-seq
MIRT1530597	hsa-miR-514	CLIP-seq
MIRT1530598	hsa-miR-661	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
615600	26421	ENSG00000018869

Q96NG8

Protein name

Zinc finger protein 582

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	255 → 277	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	283 → 305	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	395 → 417	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	367 → 389	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	339 → 361	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	311 → 333	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	227 → 249	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	423 → 445	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	199 → 221	Zinc finger, C2H2 type	Domain
PF01352	KRAB	7 → 46	KRAB box	Family

Sequence

MSLGSELFRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLGLAVSKPDVISFLEQ
GKEPWMVERVVSGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQD
DWECRNQFDRQQGNPDRHFHQMIIRHEEMPTFDQHASLTFYQKIHTREKPFGYNKCRKDF
WQKELLINHQGIYTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGS
NFIQHQRVHTGEKPYECKDCEKAFSRSSQLIEHQRTHTGEKPYQCKECGKAFNRISHLKV
HYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGRKLYECKECGKAFNQGSTLIRHQRI
HTGEKPYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIHTGE
KPYECKECGKAFSHCSQLIHHQVIHTEKKPYEYKECEKTLSHDSTTVQPQRMHNRETHVN
IINVEKPSISSYPLLIIREFMLASNHMNGSNGESPLA

Sequence length

517

Interactions

View interactions

Reactome Pathway
Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ZNF582-related disorder	Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (22)
Adenocarcinoma	Adenocarcinoma	BEFREE	24407576, 25985991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	30060049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	30060049, 38160718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27215978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	27293491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36966163	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24407576, 39304838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22815913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22815913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27215978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28241446, 31629253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27865370, 28960639, 29224816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27865370, 28960639, 29224816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29224816, 31629253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22815913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33038291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22815913, 27651839, 31629253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24407576, 25985991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28241446, 31629253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22815913, 35922105, 38160718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	25985991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22815913, 25985991, 27293491, 28241446, 39304838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with ZNF582 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for ZNF582.

Diseases Linked via Similar Genes Diseases curated for genes most similar to ZNF582 (see Related Genes above), that are NOT already directly curated for ZNF582 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to ZNF582.

ZNF582 (zinc finger protein 582)

Bookmark This Gene