ZNF570 (zinc finger protein 570)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 148268
Gene name Zinc finger protein 570
Gene symbol ZNF570
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.12
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1530191 hsa-miR-488 CLIP-seq
MIRT1530192 hsa-miR-656 CLIP-seq
MIRT1530193 hsa-miR-759 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96NI8
Protein name Zinc finger protein 570
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 386 → 408 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 218 → 240 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 246 → 268 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 274 → 296 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 470 → 492 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 358 → 380 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 414 → 436 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 302 → 324 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 498 → 520 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 442 → 464 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 330 → 352 Zinc finger, C2H2 type Domain
PF01352 KRAB 13 → 54 KRAB box Family
Sequence 
MAVGLLKAMYQELVTFRDVAVDFSQEEWDCLDSSQRHLYSNVMLENYRILVSLGLCFSKP
SVILLLEQGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTSYNL
EYSSLREEWKCEGYFERQPGNQKACFKEEIITHEEPLFDEREQEYKSWGSFHQNPLLCTQ
KIIPKEEKVHKHDTQKRSFKKNLMAIKPKSVCAEKKLLKCNDCEKVFSQSSSLTLHQRIH
TGEKPYKCIECGKAFSQRSNLVQHQRIHTGEKPYECKECRKAFSQNAHLVQHLRVHTGEK
PYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYEC
NVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQECR
KAFSQIAYLAQHQRVHTGEKPYECIECGKAFSNDSSLTQHQRVHTGEKPYECTVCGKAFS
YCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHIGESLSPPNPVNHQVL
Sequence length 536
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway

No strongly related genes found yet for ZNF570.

No additional diseases found yet through genes similar to ZNF570.