ZNF540 (zinc finger protein 540)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 163255
• Gene name: Zinc finger protein 540
• Gene symbol: ZNF540
• Synonyms (NCBI Gene): Nbla10512
• Chromosome: 19
• Chromosome location: 19q13.12

miRNA Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019918	hsa-miR-375	Microarray	20215506
MIRT1528522	hsa-miR-330-3p	CLIP-seq
MIRT1528523	hsa-miR-4640-5p	CLIP-seq
MIRT1528524	hsa-miR-4726-5p	CLIP-seq
MIRT1528525	hsa-miR-1257	CLIP-seq
MIRT1528526	hsa-miR-149	CLIP-seq
MIRT1528527	hsa-miR-203	CLIP-seq
MIRT1528528	hsa-miR-433	CLIP-seq
MIRT1528529	hsa-miR-4778-3p	CLIP-seq
MIRT1528530	hsa-miR-648	CLIP-seq
MIRT1528531	hsa-miR-760	CLIP-seq
MIRT1528532	hsa-miR-9	CLIP-seq
MIRT2159776	hsa-miR-377	CLIP-seq
MIRT2159777	hsa-miR-411	CLIP-seq
MIRT2159778	hsa-miR-889	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000900	Function	MRNA regulatory element binding translation repressor activity	IMP	16815308
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16815308
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16815308
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16815308
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0017148	Process	Negative regulation of translation	IMP	16815308
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16815308
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 613903
• HGNC: 25331
• e!Ensembl: ENSG00000171817

Protein

• UniProt ID: Q8NDQ6
• Protein name: Zinc finger protein 540
• Protein function: May act as a transcriptional repressor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	579 → 601	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	523 → 545	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	551 → 573	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	607 → 629	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	327 → 349	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	383 → 405	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	355 → 377	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	243 → 265	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	215 → 237	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	635 → 657	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	411 → 433	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	439 → 461	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	467 → 489	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	495 → 517	Zinc finger, C2H2 type	Domain
  PF01352	KRAB	5 → 46	KRAB box	Family
  PF13912	zf-C2H2_6	298 → 310		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in several fetal tissues, including gut, heart, brain, muscle, lung, testis and liver. {ECO:0000269|PubMed:16815308}.
• Sequence:

  MAHALVTFRDVAIDFSQKEWECLDTTQRKLYRDVMLENYNNLVSLGYSGSKPDVITLLEQ
  GKEPCVVARDVTGRQCPGLLSRHKTKKLSSEKDIHEISLSKESIIEKSKTLRLKGSIFRN
  EWQNKSEFEGQQGLKERSISQKKIVSKKMSTDRKRPSFTLNQRIHNSEKSCDSHLVQHGK
  IDSDVKHDCKECGSTFNNVYQLTLHQKIHTGEKSCKCEKCGKVFSHSYQLTLHQRFHTGE
  KPYECQECGKTFTLYPQLNRHQKIHTGKKPYMCKKCDKGFFSRLELTQHKRIHTGKKSYE
  CKECGKVFQLIFYFKEHERIHTGKKPYECKECGKAFSVCGQLTRHQKIHTGVKPYECKEC
  GKTFRLSFYLTEHRRTHAGKKPYECKECGKSFNVRGQLNRHKTIHTGIKPFACKVCEKAF
  SYSGDLRVHSRIHTGEKPYECKECGKAFMLRSVLTEHQRLHTGVKPYECKECGKTFRVRS
  QISLHKKIHTDVKPYKCVRCGKTFRFGFYLTEHQRIHTGEKPYKCKECGKAFIRRGNLKE
  HLKIHSGLKPYDCKECGKSFSRRGQFTEHQKIHTGVKPYKCKECGKAFSRSVDLRIHQRI
  HTGEKPYECKQCGKAFRLNSHLTEHQRIHTGEKPYECKVCRKAFRQYSHLYQHQKTHNVI
  

• Sequence length: 660

Pathways

Reactome Pathway:

Generic Transcription Pathway

Related Genes

No strongly related genes found yet for ZNF540.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to ZNF540.