ZNF516-DT (ZNF516 divergent transcript)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 400658 |
| Gene name | ZNF516 divergent transcript |
| Gene symbol | ZNF516-DT |
| Synonyms (NCBI Gene) |
C18orf65
|
| Chromosome | 18 |
| Chromosome location | 18q23 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q6ZTR6 |
| Protein name | Putative uncharacterized protein ZNF516-DT (ZNF516 divergent transcript) |
| Family and domains | |
| Sequence |
MRVPPAGTWALRPIWTEMGTPLRGSQAPGRIVLLLLVITPQWRWIPSKTPNVAPRSNQRC |
| Sequence length | 163 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ZNF516-DT across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ZNF516-DT (see Related Genes above), that are NOT already directly curated for ZNF516-DT itself -- a lead worth checking, not a confirmed association.
0
|
|