ZNF511 (zinc finger protein 511)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 118472
Gene name Zinc finger protein 511
Gene symbol ZNF511
Synonyms (NCBI Gene)
Zfp511
Chromosome 10
Chromosome location 10q26.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT048401 hsa-miR-100-5p CLASH 23622248
MIRT041055 hsa-miR-505-3p CLASH 23622248
MIRT2378753 hsa-miR-3136-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NB15
Protein name Zinc finger protein 511
Protein function May be involved in transcriptional regulation.
Family and domains
Sequence 
MQLPPALCARLAAGPGAAEPLPVERDPAAGAAPFRFVARPVRFPREHQFFEDGDVQRHLY
LQDVIMQVADVPEKPRVPAFACQVAGCCQVFDALDDYEHHYHTLHGNVCSFCKRAFPSGH
LLDAHILEWHDSLFQILSERQDMYQCLVEGCTEKFKTSRDRKDHMVRMHLYPADFRFDKP
KKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRIPSTICFGQGAAR
GFKSNKKKTKQC
Sequence length 252
Interactions View interactions

No strongly related genes found yet for ZNF511.

No additional diseases found yet through genes similar to ZNF511.