ZNF503-AS2 (ZNF503 antisense RNA 2)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100131213 |
| Gene name | ZNF503 antisense RNA 2 |
| Gene symbol | ZNF503-AS2 |
| Synonyms (NCBI Gene) |
C10orf41NCRNA00245
|
| Chromosome | 10 |
| Chromosome location | 10q22.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A6NEH8 |
| Protein name | Putative uncharacterized protein encoded by ZNF503-AS2 (ZNF503 antisense RNA 2) |
| Family and domains | |
| Sequence |
MGVWGKKHLRLTHAPSPTFSHLPPSPQAGEPGIDGISLAVVCAAFIRIHPARRHPARNGS |
| Sequence length | 195 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ZNF503-AS2 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ZNF503-AS2 (see Related Genes above), that are NOT already directly curated for ZNF503-AS2 itself -- a lead worth checking, not a confirmed association.
0
|
|