ZNF479 (zinc finger protein 479)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 90827
Gene name Zinc finger protein 479
Gene symbol ZNF479
Synonyms (NCBI Gene)
HKr19KR19
Chromosome 7
Chromosome location 7p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617444 23258 ENSG00000185177
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96JC4
Protein name Zinc finger protein 479 (Zinc finger protein Kr19) (HKr19)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 269 → 291 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 297 → 319 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 381 → 403 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 353 → 375 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 409 → 431 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 241 → 263 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 437 → 459 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 325 → 347 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 465 → 487 Zinc finger, C2H2 type Domain
PF01352 KRAB 15 → 56 KRAB box Family
Tissue specificity TISSUE SPECIFICITY: Expressed primarily in testis and fetal tissues. {ECO:0000269|PubMed:11410164}.
Sequence 
MAKRPGPPGSREMGLLTFRDIAIEFSLEEWQCLDCAQRNLYRDVMLENYRNLVSLGIAVS
KPDLITCLEQNKESQNIKRNEMVAKHPVTRSHFTQDLQPEQGIKDSLQKVIPRTYGKCGH
EKLQFKKCCKSVGEYEVHKGGYSEVNQCLSTTQNKIFQTHKYVKVFGKFSNSNRDKTRYT
GNKHFKCNKYGKSFCMLSHLNQHQVIHTREKSYKCKECGKSFNCSSNHTTHKIIHTGEKP
YRCEECGKAFSWSANLTRHKRTHTGEKPYTCEECGQAFRRSSALTNHKRIHTGERPYKCE
ECGKAFSVSSTLTDHKRIHTGEKPCRCEECGKAFSWSSNLTRHKRIHTREKPYACEECGQ
AFSLSSNLMRHRRIHTGEKPYTCEECGQDFRRSSALTIHKRIHTGERPYKCEECGKVFSL
SSTLTDHKRIHTGERPYKCEECGKAFSLSSTLTDHKRIHTGERPYTCEECGKAFNCSSTL
MQHKRIHTGEKPYKCEECEQAFKWHSSLAKHKIIHTGEKPYKCE
Sequence length 524
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Generic Transcription Pathway

No strongly related genes found yet for ZNF479.

No additional diseases found yet through genes similar to ZNF479.