ZNF414 (zinc finger protein 414)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84330
Gene name Zinc finger protein 414
Gene symbol ZNF414
Synonyms (NCBI Gene)
ZFP414
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1524031 hsa-miR-3127-3p CLIP-seq
MIRT1524032 hsa-miR-3943 CLIP-seq
MIRT2377862 hsa-miR-1184 CLIP-seq
MIRT1524031 hsa-miR-3127-3p CLIP-seq
MIRT1524032 hsa-miR-3943 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005515 Function Protein binding IPI 21044950, 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620980 20630 ENSG00000133250
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96IQ9
Protein name Zinc finger protein 414
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15909 zf-C2H2_8 110 → 207 C2H2-type zinc ribbon Domain
Sequence 
MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGG
AGGMQQGSSPAPDSCQPGPGPSPGLTSIVSGTSEDLRPPRRRPPPGKQIPCSSPGCCLSF
PSVRDLAQHLRTHCPPTQSLEGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCEN
CLLRFRTHRSLFKHLHVCAEHAQSPAPPPPPALDREPPAPERPPEVDPASAPGLPFPLLE
PFTTPAPAPTGPFLPYLNPAPFGLSPPRLRPFLAAAPGPPASSAAVWKKSQGAGSSPRRP
QGGSDAPSGACR
Sequence length 312
Interactions View interactions

No strongly related genes found yet for ZNF414.

No additional diseases found yet through genes similar to ZNF414.